KEGG   Bos taurus (cow): 508629Help
Entry
508629            CDS       T01008                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial precursor
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00053  Ascorbate and aldarate metabolism
bta00071  Fatty acid degradation
bta00280  Valine, leucine and isoleucine degradation
bta00310  Lysine degradation
bta00330  Arginine and proline metabolism
bta00340  Histidine metabolism
bta00380  Tryptophan metabolism
bta00410  beta-Alanine metabolism
bta00561  Glycerolipid metabolism
bta00620  Pyruvate metabolism
bta01100  Metabolic pathways
Module
bta_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    508629 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    508629 (ALDH2)
   00620 Pyruvate metabolism
    508629 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    508629 (ALDH2)
   00561 Glycerolipid metabolism
    508629 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    508629 (ALDH2)
   00310 Lysine degradation
    508629 (ALDH2)
   00330 Arginine and proline metabolism
    508629 (ALDH2)
   00340 Histidine metabolism
    508629 (ALDH2)
   00380 Tryptophan metabolism
    508629 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    508629 (ALDH2)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     508629 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 508629
NCBI-ProteinID: NP_001068835
BGD-bta: BT28617
Ensembl: ENSBTAG00000008743
UniProt: P20000
LinkDB All DBs
Structure
PDB: 

Position
17
AA seq 520 aa AA seqDB search
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVLYNQIFINNEWHDAVSKKTFPTV
NPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNV
IPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTE
QGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgttgcgcttgccgccgcccgcctcggaccccgccagggccgccgcctg
ctgtccgccgccacccaggccgtgccgacccccaaccagcagcctgaagtcttgtacaac
cagatctttataaacaatgagtggcatgatgccgtcagcaagaaaaccttccccacggtc
aatccatccactggggatgtcatctgtcacgtggctgaaggggacaaggcagacgtggac
agagcagtgaaggctgcccgggccgcattccagctgggctcgccctggcgccgcatggac
gcgtccgagaggggccggctgctgaaccgcctggctgatctgattgagcgagaccggacc
tacttggcagccttggagaccctggacaacggcaagccctatatcatctcctacctggtg
gatctggacatggtcctcaagtgcctgcgttactatgccggctgggctgacaaataccat
gggaaaaccattcccattgacggggactacttcagctacacccgccatgaacctgtggga
gtgtgtgggcagatcatcccatggaacttcccgctcctgatgcaagcctggaaactgggc
ccagccttggcgacgggaaacgtggttgtgatgaaggtggctgagcagactccactcact
gccctctatgtggccaacctgattaaggaggctggctttcctccgggtgtggtcaatgtt
attcctggatttggccccacggcgggagctgccatcgcctcccatgaggacgtggacaaa
gtggctttcaccggctccactgaggttggccacctaatccaggttgctgcggggaagagt
aacctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagat
gctgatatggactgggccgtggagcaggcccacttcgccctgttcttcaaccagggccag
tgctgctgtgcaggctcgcggacctttgtgcaggaggacatttacgccgagtttgtggaa
cggagtgttgcccgggccaagtctcgtgtggttgggaacccctttgacagccggactgag
caggggccgcaggtggatgaaacgcagtttaagaaggtccttggctatatcaaatctggg
aaggaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttc
atccagcccactgtgtttggagacgtgcaagatggcatgaccatcgcaaaggaggagatc
tttgggccagtgatgcagattctgaagttcaagagcatggaggaagtcgtcgggagagcc
aacaattccaagtacgggctggctgcagctgtcttcacgaaggacttggacaaggccaat
tacctgtcccaggccctccaggctggcactgtgtgggtcaactgctatgacgtgtttggg
gcccagtcgccgttcggtggctacaagctgtctgggagtggccgggagctgggggaatac
gggctgcaggcgtacaccgaagtgaagaccgtcacagtcagagttcctcagaagaactcc
taa

DBGET integrated database retrieval system