KEGG   Bos taurus (cow): 519777
Entry
519777            CDS       T01008                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    519777 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    519777 (KMT5C)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     519777 (KMT5C)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     519777 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 519777
NCBI-ProteinID: XP_002695433
BGD-bta: BT25135
Ensembl: ENSBTAG00000014087
VGNC: 30695
UniProt: E1B8M1
LinkDB
Position
18
AA seq 457 aa
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEELLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRLRPREPLPPRPLDKYELRETKRRLQQGLDGPRSCAHPPPPRRDPFCAACQPLRPPPC
SARLDASPLWLHWLPQPQLRVRPRRRRRLRLQPRQALPPPVLPAARVSLHRWGGCGPHCR
LRAEARVALVQAPRACWAPQQDWHWARRYGLPSVVRVDLSRVVPALPATANPAPSGTPGP
IPVPKQALAFTPFSPPKRLRLVVSHGSIDLDVNSDGP
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggggcccgacagagtaaccgctagagaactgtgtgagaatgacgacctggccaccagc
ctcgtcctggacccctacctcggcttccgcacccacaagatgaacgtcagccccgtgccc
cccctgcgacgacagcaccacctgcgctcagctctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccacggcaggaagctgccctcaagacccacatctatcgctacctccgcgccttc
ctgcctgaaagtggcttcaccatcttgccctgtacccgttattccatggagacaaatgga
gccaagattgtgtcaactcgcgcatggaaaaagaacgagaagctggagctgctggtgggc
tgcatcgcggagctgcgggaggccgacgaggagctgctgagagcaggggagaacgacttc
agcatcatgtactcaacccgcaagcgcagcgctcagctgtggctcggccctgccgccttc
atcaaccacgactgcaaacccaactgcaagtttgtgcctgcagatggaaacgcagcgtgc
gtgaaggtgctccgggacatcgagccaggggacgaggtgacctgtttctacggcgagggc
ttcttcggcgagaagaatgagcactgtgaatgctacacctgtgaaaggagaggggagggc
gctttccgactgcggcccagggagcccctgccgccccgacctctggacaagtacgagctc
cgggagaccaaacggcggttgcagcaaggtctggacgggccccggtcctgtgcccaccca
cccccgccgcgccgggaccccttctgcgccgcctgccagcccctgcgccccccaccctgc
agcgcccgacttgatgcctcacccctctggctccactggctgcctcagccccagctccgg
gtgcgtccccggagacgccgacgcctgcgcctgcagccccggcaagccctgccgcctcca
gttctcccagctgcccgcgtctccctgcaccggtggggaggctgcggcccccactgccgc
ctacgggcggaggcccgggtggccttggttcaggccccccgcgcctgctgggccccccag
caggactggcactgggcccggcgctacgggctgccttctgtggtccgtgtggatctgagc
cgcgtggtgccagccctgcctgccactgccaaccctgccccctctgggaccccaggtccc
atccctgtccccaagcaggcccttgccttcacccccttctccccacccaagcgcctgcgg
cttgtggtcagccatggctccattgacttggatgtcaacagcgatgggccatga

DBGET integrated database retrieval system