Bos taurus (cow): 613618 Help Entry 613618            CDS       T01008                                  Symbol H2AZ2 Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism bta  Bos taurus (cow) Pathway bta03082   ATP-dependent chromatin remodeling bta04217   Necroptosis bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     613618 (H2AZ2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     613618 (H2AZ2)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     613618 (H2AZ2)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     613618 (H2AZ2)   09165 Substance dependence    05034 Alcoholism     613618 (H2AZ2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     613618 (H2AZ2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     613618 (H2AZ2) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     613618 (H2AZ2) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    613618 (H2AZ2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  613618 NCBI-ProteinID:  NP_001033286 BGD-bta:  BT19242 Ensembl:  ENSBTAG00000016975 VGNC:  83607 UniProt:  Q32LA7 LinkDB All DBs Position 4:76689382..76701177 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaagctggaaaggacagtgggaaggccaaggccaaggcagtgtctcgc tcacagagagctgggctacagtttcccgtgggccgcatccatagacatttgaagactcgt accacgagccacggaagggtcggtgccactgctgcagtgtatagtgctgcaattctggag tacctcactgctgaggtgctggagctggcaggtaatgcatccaaggatctcaaagttaag cggatcactccacgccacttgcagcttgcaatccgtggtgatgaagagttggattctctt atcaaagctaccatagctgggggtggagtgatccctcacatccacaagtctctgattgga aagaagggacagcagaaaactgcttag

DBGET integrated database retrieval system