Budorcas taxicolor (takin): 128044567 Help Entry 128044567         CDS       T08909                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism btax  Budorcas taxicolor (takin) Pathway btax04014   Ras signaling pathway btax04015   Rap1 signaling pathway btax04022   cGMP-PKG signaling pathway btax04024   cAMP signaling pathway btax04062   Chemokine signaling pathway btax04071   Sphingolipid signaling pathway btax04072   Phospholipase D signaling pathway btax04144   Endocytosis btax04150   mTOR signaling pathway btax04270   Vascular smooth muscle contraction btax04310   Wnt signaling pathway btax04350   TGF-beta signaling pathway btax04360   Axon guidance btax04510   Focal adhesion btax04520   Adherens junction btax04530   Tight junction btax04611   Platelet activation btax04621   NOD-like receptor signaling pathway btax04625   C-type lectin receptor signaling pathway btax04660   T cell receptor signaling pathway btax04670   Leukocyte transendothelial migration btax04722   Neurotrophin signaling pathway btax04810   Regulation of actin cytoskeleton btax04921   Oxytocin signaling pathway btax04928   Parathyroid hormone synthesis, secretion and action btax04972   Pancreatic secretion btax05100   Bacterial invasion of epithelial cells btax05132   Salmonella infection btax05133   Pertussis btax05135   Yersinia infection btax05152   Tuberculosis btax05163   Human cytomegalovirus infection btax05200   Pathways in cancer btax05203   Viral carcinogenesis btax05205   Proteoglycans in cancer btax05206   MicroRNAs in cancer btax05210   Colorectal cancer btax05417   Lipid and atherosclerosis btax05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:btax00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     128044567 (RHOA)    04015 Rap1 signaling pathway     128044567 (RHOA)    04310 Wnt signaling pathway     128044567 (RHOA)    04350 TGF-beta signaling pathway     128044567 (RHOA)    04072 Phospholipase D signaling pathway     128044567 (RHOA)    04071 Sphingolipid signaling pathway     128044567 (RHOA)    04024 cAMP signaling pathway     128044567 (RHOA)    04022 cGMP-PKG signaling pathway     128044567 (RHOA)    04150 mTOR signaling pathway     128044567 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128044567 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128044567 (RHOA)    04520 Adherens junction     128044567 (RHOA)    04530 Tight junction     128044567 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128044567 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     128044567 (RHOA)    04621 NOD-like receptor signaling pathway     128044567 (RHOA)    04625 C-type lectin receptor signaling pathway     128044567 (RHOA)    04660 T cell receptor signaling pathway     128044567 (RHOA)    04670 Leukocyte transendothelial migration     128044567 (RHOA)    04062 Chemokine signaling pathway     128044567 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     128044567 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     128044567 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     128044567 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     128044567 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     128044567 (RHOA)   09158 Development and regeneration    04360 Axon guidance     128044567 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128044567 (RHOA)    05206 MicroRNAs in cancer     128044567 (RHOA)    05205 Proteoglycans in cancer     128044567 (RHOA)    05203 Viral carcinogenesis     128044567 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     128044567 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     128044567 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     128044567 (RHOA)    05135 Yersinia infection     128044567 (RHOA)    05133 Pertussis     128044567 (RHOA)    05152 Tuberculosis     128044567 (RHOA)    05100 Bacterial invasion of epithelial cells     128044567 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128044567 (RHOA)    05418 Fluid shear stress and atherosclerosis     128044567 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btax04131]     128044567 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:btax04147]     128044567 (RHOA)    04031 GTP-binding proteins [BR:btax04031]     128044567 (RHOA) Membrane trafficking [BR:btax04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     128044567 (RHOA) Exosome [BR:btax04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128044567 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    128044567 (RHOA)   Exosomal proteins of colorectal cancer cells    128044567 (RHOA)   Exosomal proteins of bladder cancer cells    128044567 (RHOA) GTP-binding proteins [BR:btax04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     128044567 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  128044567 NCBI-ProteinID:  XP_052492823 LinkDB All DBs Position 1:complement(9817893..9868308) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system