KEGG   Burkholderia thailandensis E264: BTH_II1927Help
Entry
BTH_II1927        CDS       T00311                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bte  Burkholderia thailandensis E264
Brite
KEGG Orthology (KO) [BR:bte00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTH_II1927 (ahpF)
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BTH_II1927 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Glutaredoxin FAD_binding_3 DAO HI0933_like Thi4 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ABC36245
UniProt: Q2T3X8
LinkDB All DBs
Position
II:2341168..2342973
Genome map
AA seq 601 aa AA seqDB search
MDAGRRHAHAVARPDRQDLTPHGGTAAVCAARRRVVRGPLPAPLAPRPPRPHTAGQYLLR
YGIRIVMLDANLKTQLKSYLERITRPVELVASLDDGDKSRELRALLDEIASLSPQVFVVE
RRDEAERAPSFSVGEPGEAARIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDATIEQIRA
LDGDYTFETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVDARRIMAVPTI
FLNGETFGQGRSSVREILAKLDSGASRRAAQALAAKPVFDMLIVGGGPAGAAAAIYAARK
GISTGVVAERFGGQVLDTMAIENFVSVTETEGPKFATALEQHVKQYEVDVIDVQRADRLV
PGSLHEIRLASGAVLKAKAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRV
AVVGGGNSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVTVLTHARTTELA
GDGARLNALVYEDMRTGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGAT
SVPGVFAAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSDADAVQPADADAPASAEVVA
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccgggcgccgacacgctcacgccgtcgctcgacctgatcggcaagatctgacg
ccgcacggcggcaccgccgccgtatgcgccgcgcggcgccgcgtcgttcgcggcccgctc
cccgcgccgctcgccccacgtccgccccgcccgcatacggcgggacagtacctccttcgc
tacggaatccgaatcgtcatgctggatgccaatctcaagactcagttgaaatcgtacctt
gaacggatcacgcgtcccgtcgagctcgtcgcatcgctcgacgacggcgacaagtcgcgc
gagctgcgcgcgctgctcgacgagatcgcgtcgctgtcgccgcaagttttcgtcgtcgag
cgccgcgacgaggccgagcgcgcgccgtcgttctcggtcggcgagccgggcgaagccgcg
cgcattcgcttcgccgggataccgatgggccatgaattcacgtcgctcgtgctcgcgctg
ctgcaaacgggcggccatccggtgaagctcgacgacgcgacgatcgagcaaattcgcgcg
ctcgacggcgactacacgttcgagacgtatatctcgctcacctgtcagaactgcccggaa
gtcgtgcaggcgctcaacgtgatggcgctcgtcaacccgcgcatccgccacgtgatgatc
gacggtgcgttgttccaggacgaagtcgacgcgcgccggatcatggccgtgccgacgatc
ttcctgaatggcgagacgttcggccagggccgcagcagcgtgagggaaatcctcgcgaag
ctcgatagcggcgcgagccggcgcgcggcgcaggcgctcgcggcaaagcccgtgttcgac
atgctgatcgtcggcggcggccccgccggcgcggccgccgcgatctacgcggcgcgcaag
ggcatctcgacgggcgtcgtcgccgagcgcttcggcggccaggtgctcgacacgatggcg
atcgagaatttcgtgtcggtgacggaaaccgaagggccgaagttcgcgaccgcgctcgag
cagcacgtgaagcaatacgaagtcgacgtgatcgacgtgcagcgcgccgaccggctcgtg
ccgggcagtctccatgaaatccgtctcgcgagcggcgcggtgctgaaagcgaaggccgtc
gtgctcgccacgggcgcgcgctggcgggagatcggcgtgcccggcgagcgcgagtatcgc
aaccgcggcgtcgcgtactgcccgcattgcgacgggccgcttttcaagggcaagcgcgtc
gcggtggtcggcggcggcaactcgggcgtcgaggcggcgatcgatctcgccggcatcgtc
agtgaagtgacgctgatcgaatacggcgcgcaactgcgcgcggacgaggtgctgcaacgc
aagctgcgcagcctcccgaacgtgacggtgctcacgcacgcgcgcacgaccgagctcgcg
ggcgacggcgcgaggctcaacgcgctcgtctacgaggacatgcgcacgggcgaaacgaag
cgcatcgcgctcgaaggcgtgttcgtgcagatcggcctcgtgccgaacaccgaatggctg
aagggaacggtcgagctgtcgaaacacggcgagatcgtcgtcgacgcgcgcggcgcgacg
tcggtgcccggggtgttcgccgccggcgacgtgacgaccgtgccgtacaagcagatcgtg
atcgcggtcggcgaaggcgcgaaggcgtcgctcggcgcgttcgactacctgatccgaagc
gacgcggatgcggtgcagccggcggacgccgacgccccggcaagcgccgaagtggtggcc
gcctga

DBGET integrated database retrieval system