KEGG   Burkholderia territorii: WS51_20530Help
Entry
WS51_20530        CDS       T04843                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btei  Burkholderia territorii
Pathway
btei00473  D-Alanine metabolism
btei01100  Metabolic pathways
btei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btei00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    WS51_20530
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    WS51_20530
Enzymes [BR:btei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     WS51_20530
Peptidoglycan biosynthesis and degradation proteins [BR:btei01011]
 Precursor biosynthesis
  Racemase
   WS51_20530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOI65963
UniProt: A0A107JJA6
LinkDB All DBs
Position
1:complement(2165042..2166112)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRYAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYVPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGQSADIADTGLKPAMTLASELI
AVQTIGKGQAIGYGSTFSAPAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCGTIGYELMCAVASRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccataccgctgctctcgcgaacaatctctccgtc
gtccgccgatatgccggcccctccaaggtctgggcggtcgtcaaggccaacgcgtacggc
cacggtctcgcgcgcgtgtttcccggcctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgagctcggctgggccggcccgatactgctgctcgaa
gggttctttcgctcgaccgacatcgacgtgatcgaccgctacagcctgacgaccaccgtc
cacaacgacgagcagatgcggatgctggagacggcgcggttgtccaagcccgtcaacgtg
cagctcaagatgaacagcgggatgaaccggctcggctacgtgcccgagaaataccgcgcc
gcgtgggaacgcgcccgtgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggatgccgacaacgagcgcggcgtggccgagcagctcgcgacgttcgagcgcggtgcg
gaaaacattgccggtgcccgcagtctcgcgaattcggcggcggtgctgtggcatccggat
acgcatttcgactgggtgcggcccgggatcgtgctgtacggcgcatcgccgtcggggcag
tcggccgatattgccgataccggattgaagcccgcgatgacgctcgcgtccgagctgatc
gccgtgcagacgatcgggaaggggcaggcgatcggctacggctcgacgttctccgcgccg
gcgccgatgcgcatcggcgtcgtcgcgtgcggctatgcggacggctatccgcgcgtcgcg
cccgaaggcacgccggtgatcgtcgacgggatccgcacgcggatcgtcggccgcgtgtcg
atggacatgattaccgtcgacctgacgccgtgcccgcaagccggcgtcggcgcgcgggtc
gagctgtggggcaacgcactgccgatcgacgacgtcgcgcgccattgcgggacgatcggc
tatgaactgatgtgcgcggtcgcgagccgcgtaccggtgcgcgcggaataa

DBGET integrated database retrieval system