KEGG   Burkholderia thailandensis 2003015869: DR62_3222Help
Entry
DR62_3222         CDS       T03763                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha00473  D-Alanine metabolism
btha01100  Metabolic pathways
btha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btha00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DR62_3222
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DR62_3222
Enzymes [BR:btha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DR62_3222
Peptidoglycan biosynthesis and degradation proteins [BR:btha01011]
 Precursor biosynthesis
  Racemase
   DR62_3222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIP62773
UniProt: A0A1B4JWR2
LinkDB All DBs
Position
1:complement(3266667..3267737)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLTVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNI
QLKMNSGMNRLGYAPEKFRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSLANSAAVLWHPSAHFDWVRPGIMLYGASPSGHSADIAGKGLQPTMTLASELI
AVQTLAKGQAVGYGSVFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagccctcgcgaacaatctcaccgtc
gtgcgccgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtacggg
cacggtctcgcacgggtctttcccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgagctcggctgggccgggccgatcctgctgctcgaa
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtcaacatt
caactgaagatgaacagcggaatgaaccggctcggctacgcgccggagaagttccgcgcc
gcgtgggagcgtgcgcgcgcgtgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcattgccggcgcgcgcagcctcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgattgggtgcggcccggcatcatgctgtacggcgcgtcgccgtccgggcat
tcggcggacatcgcgggcaagggcctgcagccgacgatgacgctcgcctccgaactgatc
gccgtgcagacgctcgcgaaggggcaggcggtgggctacggctccgtgttcgtcgccgag
gatacgatgcgcatcggcgtcgtcgcgtgcggctacgcggacggttatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacccccgtgccgcaggccggcgtcggcgcgcgcgtc
gagctttggggcgagacgctgccgatcgacgacgtcgccgcgcgctgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgccggtgcgtgccgagtaa

DBGET integrated database retrieval system