KEGG   Burkholderia thailandensis E254: BTN_3076Help
Entry
BTN_3076          CDS       T03380                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bthe  Burkholderia thailandensis E254
Pathway
bthe00473  D-Alanine metabolism
bthe01100  Metabolic pathways
bthe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bthe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTN_3076 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BTN_3076 (alr)
Enzymes [BR:bthe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BTN_3076 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bthe01011]
 Precursor biosynthesis
  Racemase
   BTN_3076 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIT22155
LinkDB All DBs
Position
1:complement(3458217..3459287)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLTVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNI
QLKMNSGMNRLGYAPEKFRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSLANSAAVLWHPSAHFDWVRPGIMLYGASPSGHSADIAGKGLQPTMTLASELI
AVQTLAKGQAVGYGSVFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagccctcgcgaacaatctcaccgtc
gtgcgccgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtacggg
cacggtctcgcacgggtcttccccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgagctcggctgggccgggccgatcctgctgctcgaa
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtcaacatt
caactgaagatgaacagcggaatgaaccggctcggctacgcgccggagaagttccgcgcc
gcgtgggagcgtgcgcgcgcgtgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcattgccggcgcgcgcagcctcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgattgggtgcggcccggcatcatgctgtacggcgcatcgccgtccgggcat
tcggcggacatcgcgggcaagggcctgcagccgacgatgacgctcgcctccgaactgatc
gccgtgcagacgctcgcgaaggggcaggcggtgggctacggctccgtgttcgtcgccgag
gatacgatgcgcatcggcgtcgtcgcgtgcggctacgcggacggttatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggccggcgtcggcgcgcgcgtc
gagctttggggcgagacgctgccgatcgacgacgtcgccgcgcgctgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgccggtgcgtgccgagtaa

DBGET integrated database retrieval system