KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_04123Help
Entry
Btheta7330_04123  CDS       T04540                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00473  D-Alanine metabolism
btho01100  Metabolic pathways
btho01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Btheta7330_04123 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Btheta7330_04123 (alr)
Enzymes [BR:btho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Btheta7330_04123 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:btho01011]
 Precursor biosynthesis
  Racemase
   Btheta7330_04123 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ALJ43651
UniProt: A0A0N7IAR8
LinkDB All DBs
Position
complement(5082580..5085129)
Genome map
AA seq 849 aa AA seqDB search
MSYTIESIAEYIGARRVGEHEATIDWLLTDSRSLSFPEETLFFALPTKRNNGARYISELY
DRGVRNFVVTEEDFKRMENGEWKMENAMQQDGAQPTPNSRLSILDFSNFLIVANPLKALQ
KLAEAHRENFKIPVIGITGSNGKTIVKEWLHQLLSPDRCIVRSPRSYNSQIGVPLSVWQL
NEEAELGIFEAGISEMGEMGALKRMIKPTIGILTNIGGAHQENFFSLQEKCMEKLTLFKD
CDVVIYNGDNELISNCVAKSMLTAREIAWSCKDIERPLYISKVTKKEDHTVIAYRYLDMD
NIFCIPFIDDASIENALNCLAACLYLMTPADQITERMARLEPIAMRLEVKEGKNNCILIN
DSYNSDLASLDIALDFLVRRSEKKGLKRTLILSDILETGQSTATLYRRVAQLIKSRGINK
LIGVGAEISSCAARFEGTPERYFFPDTDALLRSGIFKTLHSEVILIKGSRVFNFDLVSEE
LELKVHETILEVNLGAMVANLNHYRSMLRHPETKMICMVKAAAYGAGSYEIAKTLQEHHV
DYLAVAVADEGSELRKAGITSSIIIMDPELTSFKTMFDYKLEPEVYNFHLLDALIKAAEK
EGITNFPIHVKLDTGMHRLGFSVDEIPLLIRRLKSQNAVIPRSVFSHFVGSDSAQFDFFT
RQQIELFEKGSQELQEAFSHKILRHICNTAGIERFPGAQFDMVRLGIGLYGVSPIDNSII
NNVSTLKTTILQIRDVPGEDTVGYSRMGHLTRPSRIAAIPIGYADGLNRHLGRGNAYCLV
NGKKAPYVGNICMDVCMIDVTDIDCREGDKAVIFGDDLPITTLSDKLGTIPYEVLTSISN
RVKRVYYQD
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatacgattgaatccatagccgaatatatcggtgcacgccgtgtcggagagcat
gaagcgacgattgattggctacttacagatagccgctctttgagctttccggaagaaacc
cttttctttgctttgcccaccaaacgtaataatggtgcacgctatatctccgaactatat
gatcggggagtgcgcaacttcgtggttacggaagaagactttaagagaatggagaatgga
gaatggaaaatggagaatgctatgcagcaggatggtgcgcagcctactcccaactctcga
ctctccattctcgatttctccaatttcttgatcgtggcgaatcctttgaaggctttgcag
aagctggccgaggctcatcgggagaatttcaagattccggtaatcggtatcacgggcagt
aatggaaagaccattgtgaaagagtggttgcatcaattattgagtccggaccgctgcatt
gtccgttcgccccgcagttataattctcagatcggcgttcccttgtccgtctggcaactg
aatgaagaagccgaattgggtattttcgaagccggtatctccgaaatgggggagatgggg
gccttgaagcgcatgattaaaccgactatcggtattctgactaatataggcggtgcccat
caggagaatttcttctcattgcaggagaaatgtatggagaagctgacactctttaaagat
tgcgatgtggtgatctataatggagataacgagctgatcagtaattgtgtggcaaagtcg
atgctgacagcccgtgagattgcatggagctgcaaggatatcgagcgccctctttatatc
agcaaggtgacaaagaaagaagaccatactgtgattgcttaccgctatctggatatggat
aatatcttctgtattccttttatagacgatgcttccatcgaaaatgcgttgaactgcctg
gcagcctgtctttatctgatgactcctgccgatcagattaccgaacggatggcacggctc
gaaccgatcgccatgcgcctggaagtaaaagaaggcaagaataattgtatactcatcaac
gatagctacaattcggacttggcttctctggatatagcactggatttcctagtacgccgt
tcggaaaagaaaggactgaaacggacacttatcttatcggatattttggagacagggcag
agtacggctacgctttaccgtcgggtagcacaactgataaagagccggggcatcaacaag
ctgatcggtgtaggagcggagatttcttcgtgtgccgctcgcttcgaaggtacgccggaa
cgatacttcttccccgatacagacgccttgctaagatcgggcatttttaaaacccttcat
tcggaagtcattctgataaaaggttcccgcgtattcaactttgatctggtatcggaagag
ctggaactgaaagtgcatgaaacgattctggaagtgaacttgggtgcgatggttgccaat
ctgaatcactatcgctccatgctccgccatccggagacgaaaatgatctgtatggtgaag
gctgctgcctacggagccggatcatacgagattgccaaaacattgcaggagcatcatgta
gattaccttgctgtagccgttgccgacgaaggctccgaactgcgtaaagcaggcatcacc
tcctccattatcatcatggaccccgaactgacatcgttcaaaacgatgttcgattataaa
ctcgaaccggaagtgtacaacttccatttgctcgatgcactgattaaggcggccgagaaa
gaaggaatcaccaacttcccgattcatgtcaaactggatacgggtatgcaccgtcttggt
ttttccgtcgatgaaattccgttgttgatccgtcgtctgaaaagtcagaatgcggttatt
ccccggtcggtattctctcattttgtgggaagtgattcggcgcaattcgacttcttcacc
cgtcagcagattgaactgttcgagaaaggttcgcaggaattgcaggaagctttctcacac
aagattctgcgtcatatctgcaatacagccggtatcgaacgttttcccggtgcgcagttt
gatatggtgcgtctggggataggactctatggggtaagcccgatcgacaattcgattatc
aataatgtaagcacgcttaagactacgattcttcagattcgggacgtgcccggagaagat
acggtaggctatagccggatgggacatctgacgcgtccttcccgcattgcggcaattcct
atcgggtatgccgatggcttgaaccgccatctgggacgtggcaatgcttactgtctggtg
aatggcaagaaagctccctatgtaggaaatatctgtatggatgtctgtatgattgacgtg
acggatatcgattgcagggaaggggacaaagctgtcatcttcggtgacgacctgccgata
accacactttcggataagttggggacgatcccttacgaagtgctgaccagcatctcgaac
cgtgtgaagcgagtctactatcaggactaa

DBGET integrated database retrieval system