KEGG   Bacillus thuringiensis HD1011: BF38_2713
Entry
BF38_2713         CDS       T03675                                 

Definition
(GenBank) NAD(P)-binding family protein
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
btw  Bacillus thuringiensis HD1011
Pathway
btw00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:btw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BF38_2713
Enzymes [BR:btw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BF38_2713
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 Pyr_redox HI0933_like K_oxygenase DAO FAD_binding_2 NAD_binding_8 FAD_oxidored GIDA FAD_binding_3 FMO-like Thi4 NAD_binding_7 Lycopene_cycl
Other DBs
NCBI-ProteinID: AJG77508
UniProt: A0A0B6B6K5
LinkDB
Position
2607021..2608001
AA seq 326 aa
MQKETAIIIGGGPCGLAAAISLQKVGINPLVIEKGNIVNAIYNYPTHQTFFSSSEKLEIG
DVAFITENRKPVRNQALAYYREVVKRKSVRVNAFERVEKVQKDGEVFQVETTKRDGSKEI
YIAKYIVVATGYYDNPNYMNVPGEELKKVAHYFKEGHPYFDRDVVVIGGKNSSVDAALEL
VKAGARVTVLYRGSEYSPSIKPWILPEFEALVRNGTIHMHFGAHVKEITEHTLTYTVDGE
TNTIQNDFVFAMTGYHPDHSFLTKMGVRIDEATGRPIYAEDTMETNAANIFIAGVIAAGN
NANEIFIENGRFHGDAIAQTIATREM
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcagaaagaaacagctatcataattggaggcggtccgtgcggattagcagcagcaatt
tcgttgcaaaaggtagggataaatccgttagtaattgaaaaaggaaacattgtaaatgcg
atttataattatccaacccatcaaacatttttctcttctagtgaaaaattagaaattggt
gatgtagcttttattacagaaaatcgtaagcctgttcgaaatcaagcgcttgcgtattat
cgtgaagtagtaaagcgtaaatctgtacgtgtaaatgcttttgaacgagtggagaaagtt
caaaaagatggagaagtttttcaggttgaaacgacaaagcgtgacggaagtaaagaaata
tatatagcgaaatatattgttgtagcaactggatattatgacaatccaaattatatgaac
gttccaggtgaggaattgaagaaggtagctcactattttaaagaaggacatccttatttt
gatcgagatgtagtagttataggtgggaaaaactcgagtgtagatgccgcgttagagctt
gttaaagctggtgcgcgtgtaacggtactatatcgcggaagtgagtattcaccaagcata
aagccgtggattttgccagagtttgaggcgttagtccgaaatggtacaattcacatgcat
ttcggggctcatgtgaaagaaattactgaacatacattaacgtatacggttgatggcgag
acaaatacaatccaaaatgattttgtatttgcgatgactggttaccatccagatcatagc
ttcttaacaaagatgggtgttcggattgatgaagcgacaggacgtccaatttatgcagag
gatacgatggaaacgaacgctgcaaatattttcattgcaggtgtaattgctgctggaaat
aatgcaaatgaaatatttattgagaacggtcgatttcatggagatgcaattgcgcaaacc
atcgcaacaagagaaatgtaa

DBGET integrated database retrieval system