KEGG   Burkholderia sp. CCGE1001: BC1001_2186Help
Entry
BC1001_2186       CDS       T01424                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00473  D-Alanine metabolism
bug01100  Metabolic pathways
bug01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BC1001_2186
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BC1001_2186
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bug01011]
    BC1001_2186
Enzymes [BR:bug01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BC1001_2186
Peptidoglycan biosynthesis and degradation proteins [BR:bug01011]
 Precursor biosynthesis
  Racemase
   BC1001_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADX55603
UniProt: E8YHP7
LinkDB All DBs
Position
1:complement(2480177..2481247)
Genome map
AA seq 356 aa AA seqDB search
MPRPLSATIHTSALANNLAVARRYAPRSKIWAVVKANAYGHGLARAFPGLRATDGFGLLD
LEEAVKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTALHSDEQLRMLEMARLSKPVNI
QLKMNSGMNRLGYTPEKFRAAWERARACQGVGQITLMTHFSDADGERGIAHQMEAFERGA
HGIAGARSLANSAATLWHPESHFDWVRPGIILYGASPSGVSAAIEGTGLQPAMTLASELI
AVQSVAEGDTVGYGSLFKARAPMRIGVVACGYADGYPRVAPEGTPVIVDGVRTRIVGRVS
MDMLTVDLTPIPTASVGSRVELWGTSLPIDDVARACGTIGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccctctccgccacgattcacacgtccgcccttgccaataacctcgccgtc
gcgcgccgctatgcgccccgctcgaaaatctgggcggtcgtcaaggccaacgcctacggg
cacggcctcgcgcgcgcttttccggggctgcgcgcaacggacggcttcgggttgctggac
ctcgaagaagccgtgaagttgcgtgaattgggctgggccggaccgattcttttgctcgag
ggcttctttcgtccgacggatatcgacgtcatcgaccgctacagcctcaccacggcgctg
cattccgacgaacagttgcgcatgctcgaaatggcgcggctgtcgaagcccgtcaacatc
cagctgaagatgaacagcggcatgaaccggctcggttacacgccggagaagttccgcgcg
gcgtgggagcgcgcgcgcgcctgtcagggcgtgggccagatcacgctgatgacccatttc
tccgacgccgacggcgagcgcggcatcgcccaccagatggaagcgttcgagcgcggcgcg
catggcattgccggcgcgcgcagcctcgccaattcggcggccacgctgtggcatcccgag
tcgcacttcgattgggtccggccgggcatcatcctgtacggcgcctcgccttcgggcgtg
tcggccgccatcgagggcaccggcttgcagccggccatgacgctcgcctccgaactgatc
gccgtgcagtccgtcgcggaaggcgacaccgtcggctacgggtcgctcttcaaggcgcgc
gcgccgatgcgcatcggcgtcgtggcgtgcggttacgccgacggctatccgcgcgtggcg
cccgagggcacgccggtgatcgtcgacggcgtgcgtacccgcatcgtcggacgtgtgtcg
atggacatgctgacggtcgacctcacgccgattcccacggcgagcgtcggctcgcgcgtc
gagctgtggggcacctcgctgcccatcgacgacgtcgcgcgcgcatgcggcacgatcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgggcggagtga

DBGET integrated database retrieval system