KEGG   Burkholderia sp. CCGE1001: BC1001_4151Help
Entry
BC1001_4151       CDS       T01424                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bug  Burkholderia sp. CCGE1001
Pathway
bug00250  Alanine, aspartate and glutamate metabolism
bug00410  beta-Alanine metabolism
bug00640  Propanoate metabolism
bug00650  Butanoate metabolism
bug01100  Metabolic pathways
bug01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BC1001_4151
   00650 Butanoate metabolism
    BC1001_4151
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC1001_4151
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BC1001_4151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bug01007]
    BC1001_4151
Enzymes [BR:bug01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BC1001_4151
Amino acid related enzymes [BR:bug01007]
 Aminotransferase (transaminase)
  Class III
   BC1001_4151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADX57554
UniProt: E8YTC2
LinkDB All DBs
Position
2:619345..620634
Genome map
AA seq 429 aa AA seqDB search
MNLKNADLKSRKDAATPRGVGVMCDFYAERAENAELWDVEGRRFIDFAAGIAVCNTGHRH
PKIVAALRDQLDHFTHTAYQIVPYASYVELAEKLNQRAPGDHPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFTGGFHGRTLMGMALTGKVAPYKLGFGPFPSDVFHAPFPNPLHGVS
TADSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPVEFVRALRKLCNEHGILLIAD
EVQTGFARTGKLFAMHHYDVVPDLMTVAKSLAGGMPLSGVIGRAEVMDAAAPGGLGGTYA
GNPLALAAAHAVLDIIDEEKLCERAVVLGERVKTKLIALQKDAPQIADVRGPGAMVAVEF
CKPGSTEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIQDTVFDEALAILEDV
IKDSVAVAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaagaacgcagacctgaagagccgcaaagacgcagccacgccgcgcggcgtc
ggcgtcatgtgcgatttttacgccgagcgcgccgaaaacgccgagctctgggatgtggag
ggccgccgcttcatcgacttcgcggcgggcattgcggtgtgcaacacggggcatcgtcat
ccgaagatcgtggcggcgctgcgcgaccagctcgatcatttcacgcacactgcatatcag
atcgtgccgtacgcgtcctatgtggaactggcggaaaagctcaatcagcgcgcgccaggc
gatcatccgaagaaaacggctttcttcaccactggcgccgaggccgtggaaaacgcaatc
aagatcgcgcgcgccgcgaccggccgtcccggcgtaatcgccttcacgggcggctttcac
ggccgcacgctgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgggcttt
gggccgttcccgtcggacgtgttccatgcgccgttcccgaatccgctgcatggcgtcagt
acggcagattcgctcaaggcaattgaattcctgttcaaggccgacatcgatccgaagcgt
gtggccgccatcattttcgagccggttcagggcgaaggcggtttctatccggcgccggtc
gagttcgtgcgcgcgctgcgcaagctgtgcaacgagcacggcattctgctgatcgcggac
gaagtgcaaaccggcttcgcgcgcaccggcaagctgttcgccatgcatcactacgacgtg
gtgcccgacctgatgacggtcgcgaagagcctcgcgggcggcatgccgctgtcgggcgtg
atcggccgcgccgaggtgatggatgcggcggcgcccggcggactcggcggcacgtacgcc
ggcaatccgctcgcgctcgccgcggcgcatgcggtgctcgacatcatcgacgaagagaag
ctctgcgagcgcgccgtcgtgctcggcgagcgcgtgaagaccaaactgatcgcgctgcaa
aaagacgcgccgcagatcgccgacgtgcgcggccccggcgccatggtggcggtcgagttc
tgcaagccgggcagcacggaaccggacgcggacttcacgaagcgcgtgcaggcgcgcgcg
ctcgaacgcgggctgctgctgctggtgtgcggcgtgtattcgaacgtggtccgcttcctg
ttcccgttgacgattcaggacaccgttttcgacgaggcgctcgccattctcgaagacgtg
atcaaggacagcgtcgctgtcgcagcctga

DBGET integrated database retrieval system