KEGG   Burkholderia sp. 2002721687: BW21_1589Help
Entry
BW21_1589         CDS       T03759                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bul  Burkholderia sp. 2002721687
Pathway
bul00473  D-Alanine metabolism
bul01100  Metabolic pathways
bul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BW21_1589 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BW21_1589 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bul01011]
    BW21_1589 (alr)
Enzymes [BR:bul01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BW21_1589 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bul01011]
 Precursor biosynthesis
  Racemase
   BW21_1589 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJY42412
UniProt: A0A0D5LEX9
LinkDB All DBs
Position
I:1718520..1719590
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLTVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDLDVIDRYSLTTAVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYAPEKFRAAWERARACPGIGQITLMTHFSDADGGRGVAEQMATFERGA
QGIAGARSLANSAAVLWHPSAHFDWVRPGIVLYGASPSGHSADIADKGLKPAMTLASELI
AVQTLAKGQAVGYGSVFVAEETMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAACCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgctgccctcgcgaacaacctcaccgtc
gtgcgccgccacgccgcccagtcgaaagtctgggcgatcgtcaaggcgaacgcgtacggg
catggtctcgcacgggtctttcccgggctgcgcggcaccgacggcttcggcctgctcgat
ctcgacgaggcggtgaagctgcgcgagctcggctgggcggggccgatcctgctgctcgaa
ggcttcttccggtcgaccgacctcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtcaacgtc
caactgaagatgaacagcggaatgaaccggctcggctatgcgccggagaagttccgcgcc
gcgtgggagcgcgcgcgcgcgtgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcggccgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggtatcgccggcgcgcgcagcctcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgactgggtgcggcctggcatcgtgctgtatggcgcgtcgccgtccgggcac
tcggcggacatcgccgacaagggcctgaagcccgcgatgacgctcgcgtccgagctgatc
gccgtgcagacgctcgcgaaagggcaggcggtgggctacggctccgtgttcgtcgccgag
gagacgatgcgcatcggcgtggtcgcgtgcggctatgcggacggctatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggcgggcgttggcgcgcgcgtc
gagctgtggggcgagacgctgccgatagacgacgtcgccgcgtgctgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgtgccgagtaa

DBGET integrated database retrieval system