KEGG   Burkholderia insecticola: BRPE64_ACDS11660Help
Entry
BRPE64_ACDS11660  CDS       T02684                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
buo  Burkholderia insecticola
Pathway
buo00473  D-Alanine metabolism
buo01100  Metabolic pathways
buo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:buo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRPE64_ACDS11660
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BRPE64_ACDS11660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:buo01011]
    BRPE64_ACDS11660
Enzymes [BR:buo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BRPE64_ACDS11660
Peptidoglycan biosynthesis and degradation proteins [BR:buo01011]
 Precursor biosynthesis
  Racemase
   BRPE64_ACDS11660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAN22920
UniProt: R4WPW1
LinkDB All DBs
Position
1:1214015..1215085
Genome map
AA seq 356 aa AA seqDB search
MPRPLSATIHTAALANNLAIARKHAPKSKIWAVVKANAYGHGLARAFPGLRATDGFGLLD
LEEAVKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTAVHCDEQLRMLEMARLSKPVNI
QLKMNSGMNRLGYTPERYRAAWERARAVQGVGQITLMTHFSDADGPRGIAHQLEAFERGA
EGISGARSLANSAAVLWHPDSHVDWVRPGIMLYGASPSGVTADIADIGLKPAMTLHSELI
AVQTVPAGHSIGYGSTFTAGKPMRIGVVACGYADGYPRVAPEGTPVIVDGVRTKLVGRVS
MDMLTVDLTPCPGAGIGSRVELWGTHLPIDDVASSAGTIGYELMCAIAQRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccctctctgcaacgatccacaccgccgcgctcgccaataacctagccatt
gcgcgaaagcacgcgccgaaatccaagatctgggccgtcgtcaaggccaatgcgtatggc
cacggtttggcccgcgcgttccccggattgcgcgcaacggacggctttggccttctcgac
ctcgaagaagccgtgaagttgcgtgagttgggctgggccgggccaattcttctgctcgaa
ggcttttttcgcccgaccgatatcgatgtcattgaccgctacagcctgaccacggccgta
cactgcgacgagcagttgcgcatgctggaaatggcgcgtctgtcgaagccggtgaacatc
cagctgaagatgaacagcggcatgaaccggctcggctacacgccggagcgttatcgcgcc
gcatgggagcgggcgcgtgcggtgcagggcgtcggccagatcacgctcatgacccatttt
tccgacgccgacggaccgcgcggcattgcgcatcaactggaggcgttcgagcgcggcgcg
gagggcatttcgggcgcgcgcagcctggcgaactcggcggcggtgctgtggcatcccgat
tcccacgtcgactgggtgcgcccgggcatcatgctgtacggcgcgtcgccgtccggtgtg
accgccgatatcgccgatatcggtctcaaacccgccatgacgctgcattccgaactgatt
gccgtgcagacggttccggccgggcacagcatcggctacggttcgaccttcacggcgggc
aagccgatgcgcatcggcgtggtcgcgtgcggctacgcggacggctatccgcgcgtggcg
ccggaaggcacgcccgtaatcgtcgatggcgtgcgcaccaagctcgtcggccgcgtgtcg
atggacatgctcaccgtcgacctgacgccgtgcccgggcgcgggcatcggttcgcgcgtc
gagctgtggggcacgcatctgccgatcgacgacgtggcaagttccgcaggcacgatcggc
tatgagctgatgtgcgcaattgcgcagcgcgtgccggtgcgcgccgagtaa

DBGET integrated database retrieval system