KEGG   Burkholderia lata: Bcep18194_B0280Help
Entry
Bcep18194_B0280   CDS       T00286                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bur  Burkholderia lata
Pathway
bur00250  Alanine, aspartate and glutamate metabolism
bur00410  beta-Alanine metabolism
bur00640  Propanoate metabolism
bur00650  Butanoate metabolism
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcep18194_B0280
   00650 Butanoate metabolism
    Bcep18194_B0280
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcep18194_B0280
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcep18194_B0280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bur01007]
    Bcep18194_B0280
Enzymes [BR:bur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bcep18194_B0280
Amino acid related enzymes [BR:bur01007]
 Aminotransferase (transaminase)
  Class III
   Bcep18194_B0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABB10396
UniProt: Q39AW5
LinkDB All DBs
Position
2:complement(298179..299468)
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAISDQLNNFTHTAYQIVPYASYVELAEKINARAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFYAAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQFGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtt
ggcgtgatgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaataccggccaccgccac
ccgaagatcgtcaaggcgatctcggatcaactgaacaacttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgagctggctgaaaagatcaacgcacgcgcaccgggc
gatttcccgaagaagaccgcgttcttcacgaccggcgcagaagccgtcgagaacgcgatc
aagatcgcgcgtgcggcgaccggccgtccgggcgtcatcgccttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgccccgtacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gttgccgcgatcatcttcgaaccggtccagggcgaaggcggcttctacgcggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgac
gaagtccagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggcagcgcccggcggcctcggcggcacgtacgcg
ggcaacccgctggccgtcgcatcggcccacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgcgcgacgcaattcggcgacgtgctgaaggcgaagctgaacgcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggctcgggcgagccggatgcggaattcacgaagcgcgtgcagacgcgtgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system