KEGG   Burkholderia sp. OLGA172: AYM40_34365Help
Entry
AYM40_34365       CDS       T05111                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
buz  Burkholderia sp. OLGA172
Pathway
buz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AYM40_34365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:buz02000]
    AYM40_34365
Enzymes [BR:buz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AYM40_34365
Transporters [BR:buz02000]
 Other Transporters
  Pores ion channels [TC:1]
   AYM40_34365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ANB77188
UniProt: A0A160FW84
LinkDB All DBs
Position
2:3249988..3250665
Genome map
AA seq 225 aa AA seqDB search
MLIVHHLNNSRSQRVLWLLEELGVPYEIKRYERDPKTMLAPPELRAVHPLGKSPVITDDG
QTLAESGAIIEYLVDKYGQGRFAPAAGTPDRLRYTYWMHYAEGSAMPPLLLKLVALRIAS
APMPFFAKPIARKIASTLQSSFIDPQLKLHLGYINKELSATGWFVGNDFTAADVQMSFPL
EAATARGGMEGQIPAVVDFLKRIHARPAYQRALERGGKYELLGGD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgtccatcatctgaacaactcccgctcgcaacgcgtgttgtggctgctcgaa
gaactcggcgtgccgtacgagatcaagcgctacgagcgcgacccgaaaacgatgctggcg
ccgcccgagctgcgcgcggtccatccgctaggcaagtcgcccgtgattaccgacgacggt
cagaccctcgccgaatccggcgcaatcatcgagtatctggtcgacaagtacggtcaaggc
cgtttcgcgcccgcagcgggcacgcctgatcggctgcgttacacctactggatgcactat
gcggaaggctcggcaatgccgccgctgctgctcaagctggtggcgctgcgcatcgccagc
gcacccatgccgttcttcgccaaaccgatcgcccgcaagatcgcctcgacgctgcaatcg
agcttcatcgatccgcagttgaagctccatctcggctacatcaataaggaattgagcgcg
acgggctggttcgtcggcaacgatttcacggcggccgatgtgcagatgagctttccgctc
gaagccgccaccgcacgcggcggcatggaagggcagattcccgccgtagtcgatttcctg
aagcgcattcacgcgcggccggcttatcaacgggcgctggagcgcggcggcaagtacgaa
ctactgggtggcgattaa

DBGET integrated database retrieval system