KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_332Help
Entry
BVAF_332          CDS       T01398                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00020  Citrate cycle (TCA cycle)
bva00190  Oxidative phosphorylation
bva00650  Butanoate metabolism
bva01100  Metabolic pathways
bva01110  Biosynthesis of secondary metabolites
bva01120  Microbial metabolism in diverse environments
bva01130  Biosynthesis of antibiotics
bva01200  Carbon metabolism
Module
bva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bva_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVAF_332 (sdhB)
   00650 Butanoate metabolism
    BVAF_332 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVAF_332 (sdhB)
Enzymes [BR:bva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVAF_332 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BVAF_332 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_18 Fer4_7 Fer4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ADV33726
UniProt: E8Q6X9
LinkDB All DBs
Position
374131..374856
Genome map
AA seq 241 aa AA seqDB search
MKIKFSIYRFCPELNKVPYMQEFQINLINIYRMTLLDALIQLKEHDPTLTFRRSCREGVC
GSDGMNINGTNNLACITSLTELINRNPQKKIIIRPLPGFPVIRDLVVDMSQFYLQYQKIN
PYLINKDINKPSHEYLQSPEDRAKLDGSYECILCACCSSSCPSFWWNSDKFIGPAGLLTL
YRFLVDTRDTHSKERLKELQDSFSVFRCHNIMNCVSVCPKKLNPAQAIGKIKRMLVKNII
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaattttcaatttatcggttttgtcctgaacttaataaagttccttatatg
caagaatttcaaattaatcttataaatatatatagaatgacactgctagatgctttaatt
caattaaaagaacatgatcctactttaacatttcggagatcttgccgagaaggggtatgc
ggatcagacggaatgaatataaatggtacaaataaccttgcgtgtattacatcattgacg
gagttaatcaataggaatccacaaaaaaagattattattagaccattacctgggtttcca
gtaattcgagatttagtagtagatatgagtcaattttacttacaatatcaaaaaataaat
ccctatttaattaataaggatattaataaaccatctcatgaatatttgcaatctccagaa
gatagagctaaattagatgggtcttatgaatgtatattgtgcgcatgttgttctagttct
tgtccttcgttttggtggaattcagataaatttattggccctgctgggttattaacatta
tatcggtttttagtggatactagggatactcacagtaaagaacgattaaaagagttacaa
gattcttttagtgtttttagatgtcataatattatgaattgcgttagtgtatgcccaaaa
aaattaaacccagctcaagctataggcaaaattaaaagaatgttagttaaaaacattatt
aaataa

DBGET integrated database retrieval system