KEGG   Beta vulgaris (sugar beet): 104895015Help
Entry
104895015         CDS       T03548                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00020  Citrate cycle (TCA cycle)
bvg00190  Oxidative phosphorylation
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
bvg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104895015
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104895015
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104895015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 104895015
NCBI-ProteinID: XP_010679713
LinkDB All DBs
Position
6
AA seq 635 aa AA seqDB search
MWRCVTRGFRSHSWKTSNNPSISSQSPFSRLFSSESSAVGGASYTVVDHTYDAVVVGAGG
AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCAC
AADRTGHALLHTLYGQAMRHNTQFFVEYFALDLLMDDEGSCQGVIALNMEDGTLHRFRSK
STILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNH
LPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPD
ALVPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGDKQKPLAKDAG
EKTIQWLDKLRNSNGSLPTSQIRLNMQRVMQNNAAVFRTQSTLEEGCQLIDKTWESFHDV
KVQDRSLIWNSDLMETIELENLLINACITMHSAEARKESRGAHAREDFTTRDDENWMKHT
LGYWENEKVRLDYRPVHMNTLDDEIETFPPKARVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgttgcgtcactcgtggttttcgctctcattcatggaaaacctcaaacaatcct
tcgatctcttctcaatctcctttttccagattattttcctccgaatctagtgcggtaggt
ggcgccagctacacggtagtagaccatacctacgatgcggttgtggtaggtgcaggtggt
gcaggtttacgagccgctatcggattatcggaacacggatttaacacagcttgcattact
aagcttttccctactcgttctcacaccgttgctgctcagggtggaatcaatgctgccttg
ggtaatatgactgaagatgactggagatggcacatgtatgacacagtgaaaggaagtgac
tggctaggtgaccaggatgccatacagtatatgtgcagagaggcaccaaaagctgtaatt
gagcttgaaaactatggcttaccattctctcgtacagaagatgggaagatatatcaacgt
gcatttggtggtcaaagtttgaacttcgggaaaggggggcaagcatatcgctgcgcttgt
gccgctgatcgaacaggccatgctttattgcacactttgtatgggcaagctatgaggcat
aatacacaattttttgtagaatattttgcattggaccttcttatggatgacgaaggttct
tgccaaggtgtaattgctttaaatatggaagatgggacattgcacagattccgctctaag
tcaacaattctggctactgggggttatggtcgaacatatttttctgcaacttctgcacat
acatgtaccggagatggcaatgcaatggttgcacgtgctggccttccattggaggatctt
gaatttgtgcagttccacccaactggtatctacggtgctggatgcctaatcactgaagga
tcccgtggtgaaggtggcattctgagaaatagcgagggtgagcgttttatggaaagatat
gctccaacagccaaagatcttgcatccagggatgttgtttctagatctatgacgatggaa
attcgagaaggccgtggtgtaggaccattgaaggatcatatttacctccacctgaatcac
ttgcctccagaagtacttaaggaaagacttcctggtatctctgagacagctgctatcttt
gctggggttgatgttacaaaggaacccatccctgtcttgccaactgttcattataatatg
ggtgggattcctacaaaccaccatggagaggttgtcaccataaaaggtaatgacccagat
gcactggttcctggattattggctgctggagaggctgcttgtgcgtcagttcatggtgct
aacaggcttggtgcaaattctcttcttgacattgttgtttttggtcgagcttgtgccaac
cgagttgcggagatcagtaaaccaggggacaagcaaaaacctttggcgaaagatgctggg
gagaagactatccagtggttggacaaattaagaaattcaaatggttctcttccaacttcc
caaatccgcctaaacatgcaacgagtaatgcagaataatgctgctgtcttccgcacacag
agtacattggaagaaggttgtcaattaattgataaaacatgggagagttttcatgatgtc
aaggtccaagaccgcagcttaatttggaattctgacttgatggaaaccattgagttggaa
aatttgttgattaatgcatgcatcactatgcactctgctgaggcaaggaaagagagcaga
ggagctcatgctcgtgaagatttcactacaagagatgatgagaactggatgaaacacact
ctaggatattgggagaacgagaaggttagactagattatcggccagtgcatatgaacaca
ttggatgatgaaattgagactttcccacctaaagctcgtgtatattga

DBGET integrated database retrieval system