KEGG   Burkholderia vietnamiensis G4: Bcep1808_3543
Entry
Bcep1808_3543     CDS       T00493                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00206  phosphonoacetaldehyde dehydrogenase [EC:1.2.1.-]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00440  Phosphonate and phosphinate metabolism
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep1808_3543
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Bcep1808_3543
SSDB
Motif
Pfam: Aldedh Trm56
Other DBs
NCBI-ProteinID: ABO56530
UniProt: A4JJS7
LinkDB
Position
2:complement(272787..274241)
AA seq 484 aa
MIVHPRQDHPAFRAEALRWCGTRASRARVFDIDDPYTGTRVGTAPLASVDDVRAAFDYAI
AYRPALTRYERSQILERAAALLRARCEEASDLITLESGVSKQDSRYEIGRVADVLKFASA
EALRDDAQSFSCDLTPHGKARRVFSQRQPLDGVIVAITPFNHPMNQVAHKIAPAIATNNR
VIVKPSEKVPLSAFYLADLLYEAGLPEPMLQVLTGDPREIADELVTHPHAALITFTGGVS
IGKAIAARAGYRRIVLELGGNDPLIVLDDADLERAASLAVVGSYRNSGQRCTAVKRILVQ
RSIAPAFTELLVEKTRAWKYGDPFDVANEMGTVIDAAAARLFEARVEEAVAHGARLLTGN
VRRGALYAPTVLDNVDPSMTIVREETFGPVSPVIAFDTIDDAIRISNGTAFGLSSGVCTD
STAAVVRFVNELKVGTVNVWEVPGYRIELSPFGGIKDSGLGYKEGVQEAMKSFTNLKTFS
LPWE
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgatcgttcatccgcgccaggatcatccggcgttccgcgccgaggcgctgcgctggtgc
ggcacgcgcgcctcgcgcgcccgcgtgttcgacatcgacgatccgtacaccggcacgcgc
gtcgggaccgcgccgctggcgagcgtcgacgacgtgcgcgccgcgttcgactacgcgatc
gcgtatcggcccgcgctcacgcgctacgagcgctcgcagatcctcgaacgtgcggcggcg
ctgctgcgcgcgcgctgcgaggaggcgtccgacctcatcacgctcgagtccggggtgtcg
aagcaggactcccgctacgagatcggccgcgtcgccgacgtgctgaagttcgcgtccgcc
gaggcgctgcgcgacgacgcgcagagcttctcgtgcgatctgacgccgcacggcaaggcg
cgtcgcgtgttctcgcagcggcagccgctcgacggcgtgatcgtcgcgatcacgccgttc
aatcacccgatgaaccaggtcgcgcacaagatcgcgccggcgatcgccaccaacaaccgc
gtgatcgtgaagccgtcggagaaggtgccgctgtcggcgttctatctggccgatctgctt
tacgaagccggcttgccggagccgatgctgcaggtgctgaccggcgacccgcgcgaaatc
gccgatgagctcgtcacgcatccgcacgcagcgctgatcacgttcacgggcggcgtgtcg
atcggcaaggcgatcgcggcccgggccggctaccggcgcatcgtgctggagctgggcggc
aacgatccgctgatcgtgctcgacgatgcggatctcgagcgcgccgcatcgctggccgtg
gtgggttcgtaccgtaactccgggcagcgctgcacggcggtcaagcggatcctggtgcag
cgctcgatcgcgccggcgttcaccgagctgctcgtcgaaaagacgcgcgcgtggaagtac
ggcgatccgttcgacgtcgcgaacgagatgggaacggtgatcgacgccgcggcggcgcgc
ctgttcgaggcgcgtgtcgaagaagccgtcgcgcacggcgcgcggctgttgacgggcaac
gttcggcgcggtgcgctgtatgcaccgaccgtgctcgacaacgtcgatccgtcgatgacg
atcgtgcgtgaggagacgttcggtcccgtgtcgccggtgatcgcgttcgacacgatcgac
gacgcgatccgcatcagcaacggtacggcgttcgggttgtcgtcgggcgtgtgtacggac
agcacggcggcggtcgtgcggttcgtgaacgaactgaaggtgggcacggtgaacgtgtgg
gaggtgcccggctaccggatcgagctgtcgccgttcggcggcatcaaggattcggggctc
ggctacaaggaaggcgttcaggaggcgatgaagagcttcacgaacctgaagacgttctcg
ctgccgtgggagtag

DBGET integrated database retrieval system