KEGG   Burkholderia vietnamiensis G4: Bcep1808_3787Help
Entry
Bcep1808_3787     CDS       T00493                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00260  Glycine, serine and threonine metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep1808_3787
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Bcep1808_3787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 Pyr_redox_3 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: ABO56770
UniProt: A4JKG7
LinkDB All DBs
Position
2:complement(533704..534732)
Genome map
AA seq 342 aa AA seqDB search
MKALAKLERAPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGA
FAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAV
AIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRDVMAELRMTEGFDVGLEMS
GVPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVA
MLQSGLDLSPIVTHRFAVDDYEKGFAAMLSGESGKVILDWTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactggcaaagctcgaacgcgctccgggtctcacgttgacgcgcgtgaagcgt
cccgaggtcggacacaacgacgtgctgatcaagatccgccgcacggcgatctgcggcacc
gacatccatatctggaagtgggacgactgggcgcagaagacgatccccgtgccgatgcat
gtcggccacgaatacgtcggcgagatcgtcgagatggggcaggaagtgcgcggcttcgcg
atcggtgaccgcgtgtccggcgaagggcacatcacctgcggtttctgccgtaactgtcgt
gcggggcgtcggcatctgtgccgcaataccgtcggcgtcggcgtgaaccgcgagggcgcg
ttcgccgaatatctggcgattcccgcattcaacgcgttcaagattccgccggagatctcc
gacgatctcgcgtcgatcttcgatccgttcggcaacgcgacgcatacggcgctgtcgttc
aacctcgtcggcgaggacgtgttgatcaccggcgcggggccgatcggcatcatggccgtg
gcaatcgccaagcatgtcggcgcgcgcaatgtcgtgatcaccgacatcaacgactatcgg
ctggagcttgcgcgcaagatgggcgcgacgcgtgctgtcaacgtcgcgcgcgagtcgctg
cgcgacgtgatggccgagctgcgcatgactgaaggcttcgatgtcgggctcgagatgtcg
ggcgtgccgagcgcattcacgagcctgctcgaagcgatgaatcacggcggcaaggtcgcg
ctgctcggcattccgcccgcgcagacggcaatcgactggaatcaggtgatcttcaagggg
ctcgagatcaagggcatctacggccgcgaaatgttcgagacctggtacaagatggtcgcg
atgctccagagtgggctcgacctgtcgccgatcgtcacgcatcgctttgccgtcgacgat
tacgagaaaggcttcgccgcgatgctgtccggtgaaagcggcaaggtgattctcgactgg
accgcgtga

DBGET integrated database retrieval system