KEGG   Burkholderia vietnamiensis G4: Bcep1808_4653Help
Entry
Bcep1808_4653     CDS       T00493                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcep1808_4653
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bcep1808_4653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO K_oxygenase NAD_binding_8 Thi4 FAD_binding_3 AlaDh_PNT_C FAD_oxidored Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ABO57613
UniProt: A4JMW0
LinkDB All DBs
Position
2:complement(1482883..1484481)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDGAKSQELLALLNEIASLTSRVTVIERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDFA
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQDEVDARQIMAVPTMFLNGAT
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFAAALEQHVKQYDVDIMDVQRAEALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGNKL
NALVYKDLQSGETKRIALEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGGTSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDATPVTTAAPQPAEALAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcaactgaaagcgtacctcgaaaagatcacccgcccg
atcgaactcgtcgcctcgctcgacgacggtgcgaaatctcaggaactgcttgcgctgctg
aacgagattgcgtcgctgacgtcgcgcgtgaccgtcatcgagcgccgcgacgatgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagccggccggcatccgcttcgccggc
attccgatgggccacgaattcacgtcgctcgtcctcgcgctgctgcagaccggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagattcgcgcgctcgacggcgacttcgcg
ttcgaaacgtatttctcgctgtcatgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcactgatcaacccgcgcatccgccacgtcgcgatcgacggcgcgctgttccag
gatgaagtcgacgcacgccagatcatggccgtcccgacgatgttcctgaacggcgcaacg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacaccggcgcgagc
gcacgcgccgccaagtcgctcgaaaacaagccggtgttcgatacgctgatcgtcggcggc
ggcccggccggcgcggccgcggcgatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgacacgatggcaatcgaaaacttcgtgtcg
gtgcaggaaaccgaagggccgaagtttgcggccgcactcgagcagcacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgaggcgctgatccccggcgacgtgcatcag
atccgcctcgcgaacggcgccgtgctgaaggcgaagacgatcgttctcgcgaccggtgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtaccgcaaccgcggcgtcgcctac
tgccctcactgcgacggcccgctgttcaagggcaagcgtgtcgcggtggtcggcggcggc
aactccggcgtcgaggcggcgatcgacctcgccggcatcgtgaaggaagtcacgctgctc
gaatacggcgcacaactgcgcgccgacgaggtgctgcagcgcaagctgcgcagcctgccg
aacgtcacgatcgtcacgcaagcgcagacgaccgagctgaccggcgacggcaacaagctg
aacgcgctcgtctacaaggatctgcagtcgggcgaaacgaaacgtatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaagggacggtcgagctg
tcgaagcacggcgagatcgtcgtcgacgcccgcggggggacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgacggttccgttcaagcagatcgtgatcgcagtcggcgaaggt
gcgaaggcgtcgctcggcgcgttcgatcacctgatccggcaggacgcgacgccggtcacg
accgccgcgccgcagcccgccgaagcactcgccgcgtaa

DBGET integrated database retrieval system