KEGG   Burkholderia vietnamiensis G4: Bcep1808_4687Help
Entry
Bcep1808_4687     CDS       T00493                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00440  Phosphonate and phosphinate metabolism
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcep1808_4687
Enzymes [BR:bvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bcep1808_4687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ABO57645
UniProt: A4JMZ2
LinkDB All DBs
Position
2:complement(1523368..1525053)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSDQLEFLMEAHNGLSARIVREAGFRGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGAPHGRWIGLLNVR
GAGVERLKAMLATLQARADFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTANGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcgcgcctgcgccgcatgctg
gtcagcgaccagctcgagttcctgatggaagcgcacaacggcctgtcggcgcggatcgtg
cgcgaagccggcttcaggggaatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaagcgagctggacccaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgccgaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgagattctgcagttcgcgcgcgaatggagcggcaaggccccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcctccgcgatgcaggccgtcgcacgcgag
atccacgagaacgaaacgctgatcaacgtcgaggaccgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgtgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctggtcgtgaacgagcgccatgcacagacg
ggcgagctcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggcggag
ttcagcgtcgtcgtcgattcgtcgctgaccgaaaccaaccagagcgtgcgcgacttcgcg
ctgtgctcggcggccgacgatcgcgggctgttcggtcagaagacgtatctgcaacgcgtg
tcgagcgacgttgccgccggcgcgccgcacggccgctggatcggcttgctgaacgtgcgc
ggcgcgggcgtcgagcggctgaaggcgatgctcgcaacgctgcaggcgcgcgccgacttc
gacacgctcgacatcccgtcgctgctcaacgagctgatcgccgccggcgagaagatcgaa
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgtcgcgcg
ggcgacttcgcgcacggccagacgccgctgtcggagccgggcaccgccaacggaggcgcg
caatga

DBGET integrated database retrieval system