KEGG   Paraburkholderia xenovorans LB400: DR64_3338
Entry
DR64_3338         CDS       T03290                                 

Definition
(GenBank) hypothetical protein
Organism
bxb  Paraburkholderia xenovorans LB400
SSDB
Motif
Pfam: DUF1525 Thioredoxin_3
Other DBs
NCBI-ProteinID: AIP31207
UniProt: Q13VW7
LinkDB
Position
1:complement(3633527..3633973)
AA seq 148 aa
MPASFSRFSPRWRTLGLAVALPVALAAFCPATFAADVLVVTDSRHPLKTMGGERLIELDE
AHRIEAELSVELPADSEQAAAVVKRRLNSGGADLQRRIASAYQGVTDAWSLGITSIPAVV
VDQRYVVYGEPDVARAVARVQQHRRAQP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgccagcttctttttccaggttctcgccgcgctggcgaaccctcggcctggccgttgcg
ctgccggtggcgttggccgctttttgcccggccaccttcgccgccgacgtgctggtcgtc
accgacagccggcaccccctcaagaccatgggcggcgaacggctgatcgagctggacgaa
gcgcatcggattgaagcggagctttctgtcgaactccccgccgattctgaacaggctgcc
gccgtcgtcaagcgtcggctgaatagtggcggtgccgacctccagcgccgcattgcgtcc
gcataccagggcgtcaccgacgcatggagcctgggcatcaccagcatcccagccgtcgtg
gtggaccagcgctacgtggtctatggcgagccggacgtggcccgcgccgtcgcgcgcgtt
cagcagcaccggagggctcagccgtga

DBGET integrated database retrieval system