KEGG   Burkholderia sp. YI23: BYI23_A003030
Entry
BYI23_A003030     CDS       T01711                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BYI23_A003030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:byi01007]
    BYI23_A003030
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:byi03016]
    BYI23_A003030
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A003030
Enzymes [BR:byi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BYI23_A003030
Amino acid related enzymes [BR:byi01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BYI23_A003030
Transfer RNA biogenesis [BR:byi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BYI23_A003030
 Prokaryotic type
   Other AARSs
    BYI23_A003030
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_A003030
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA-synt_2d
Other DBs
NCBI-ProteinID: AET88141
LinkDB
Position
1:336222..338024
AA seq 600 aa
MSMRSEYCGLVTEARLGETVSLCGWVHRRRDHGGVIFIDLRDREGLVQVVCDPDRAEMFK
VAEGVRNEFCVQVKGVVRNRPEGTVNANLTSGKIEVLCHELNVLNASVTPPFQLDDDNLS
ETTRLTHRVLDLRRPQMQKNLRLRYRVAMEVRKYLDAQGFIDIETPMLTKSTPEGARDYL
VPSRVNAGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDEDLRADRQPEFTQIDCETS
FLTEQEIRDLFEAMIRHVFKETMDVELPAKFPVMLYSEAMRRFGSDKPDLRVKLEFADLT
DAVKDVDFKVFSMPANSKDGRVAALRVPKGGELSRGDIDGYTEFVRIYGAKGLAWIKVND
KTKGRDGLQSPIVKNLHDAAIAAILERTAAEDGDIIFFAADRAKVVNDSLGALRLKIGHS
EFGKANGLLETGWKPLWVIDFPMFEYDEDENRFVAAHHPFTSPKDEHLEYLETDPARCLA
KAYDMVLNGWEIGGGSVRIFQEDVQSKVFRALKIGAEEARLKFGFLLDALQYGAPPHGGI
AFGLDRIVTLMSGADSIRDTIAFPKTQRAQDLLTQAPSEVDERQLRELHIRLRQPEQKAH
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgtcgatgcgatctgaatactgcggtctggtgaccgaggcccgtctgggcgaaaccgtc
tcgctgtgcggctgggtgcatcgccgccgcgatcacggtggcgttatcttcatcgacttg
cgcgatcgcgaagggctcgttcaggtcgtctgcgatccggaccgcgccgagatgttcaag
gtggccgaaggcgtgcgcaacgagttctgcgtgcaggtgaagggcgtcgtgcgcaatcgt
cccgaaggcaccgtcaacgccaatctgacgagcggcaagatcgaagtgctgtgtcatgag
ctgaacgtgctgaacgcgtcggtgacgccgccgttccagctcgacgacgacaacctctcc
gaaaccacgcgcctcacgcatcgcgtgctcgacctgcgccgtccgcagatgcagaagaat
ctgcgcctgcgctatcgcgtcgcgatggaagtgcgcaaatatctcgacgcgcaaggcttc
atcgacatcgaaacgccgatgctcaccaagagcacgccggaaggcgcgcgcgattacctc
gtgccgtcgcgcgtgaacgcgggccagttcttcgcgctgccgcaatcgccgcagcttttc
aagcagctcttgatggtcgcgaacttcgaccgttactaccagatcaccaagtgcttccgc
gacgaagacctgcgcgccgaccgtcagccggaattcacgcagatcgactgcgaaacctcg
ttcctgaccgagcaggaaattcgcgatctgttcgaagcgatgatccggcacgtcttcaag
gagacgatggacgtcgaactgcccgcgaaattcccggtcatgctgtactcggaagccatg
cgccgcttcggttcggacaagcccgacctgcgcgtgaagctcgaattcgccgatctcacg
gatgccgtgaaggacgtcgacttcaaggtgttcagcatgccggcgaattcgaaggacggc
cgcgtggctgcgttgcgcgtgccgaagggcggcgagctctcgcgaggcgacatcgacggg
tatacggaattcgtgcgcatctatggcgcgaagggtctcgcgtggatcaaggtcaacgac
aagaccaagggtcgcgacggcctgcaaagcccgatcgtcaagaacctgcacgacgcggcg
atcgcggcgattctcgagcgcacggcggcggaagacggcgacatcatcttcttcgcggcg
gatcgcgcgaaggtcgtcaacgacagccttggcgcgctgcgtctgaagatcggtcattcg
gaattcggcaaggcgaacggtctgctcgaaaccggctggaagccgctgtgggtcatcgac
ttcccgatgttcgaatacgacgaagacgaaaaccgcttcgtggccgcgcatcatccgttc
acgagcccgaaggacgagcatctcgaatacctcgaaaccgatccggcccgctgcctcgcg
aaggcatacgacatggtgctgaacggctgggaaatcggcggcggttcggtgcgtattttc
caggaagacgtgcagagcaaggtgttccgcgcgctcaagatcggcgcggaagaagcgcgt
ctgaagttcggcttcctgctcgacgcgctgcagtacggcgcgccgccgcacggcggcatc
gcgttcggtctggaccgtatcgtcacgctgatgtccggcgccgattcgatccgcgacacc
atcgcgttcccgaagacgcagcgtgcgcaagacctgctcacgcaggcgccgagcgaagtc
gacgagcgccagttgcgcgagttgcacattcgcctgcgtcagccggagcagaaggcgcac
tga

DBGET integrated database retrieval system