KEGG   Burkholderia sp. YI23: BYI23_A003310
Entry
BYI23_A003310     CDS       T01711                                 

Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BYI23_A003310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:byi01007]
    BYI23_A003310
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:byi03016]
    BYI23_A003310
   03029 Mitochondrial biogenesis [BR:byi03029]
    BYI23_A003310
Enzymes [BR:byi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     BYI23_A003310
Amino acid related enzymes [BR:byi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BYI23_A003310
Transfer RNA biogenesis [BR:byi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BYI23_A003310
 Prokaryotic type
    BYI23_A003310
Mitochondrial biogenesis [BR:byi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BYI23_A003310
SSDB
Motif
Pfam: tRNA-synt_1b S4 S4_2 TyrRSs_C
Other DBs
NCBI-ProteinID: AET88169
LinkDB
Position
1:370105..371352
AA seq 415 aa
MTTDSNASAAQRFPITDDVKSALAIAKRGCDELLIEDEFAQKLARSAATGKPLRIKLGLD
PTAPDIHIGHTVVLNKMRQLQDLGHHVIFLIGDFTSLIGDPSGRNATRPPLTREQIEMNA
KTYFEQASLVLDREKTEIRYNSEWSMPLGADGMIKLASRYTVARILEREDFTKRFQGGVP
ISIHEFLYPLMQGYDSVALNSDLELGGTDQKFNLLVGRELQKQYGQEQQCILTMPLLEGL
DGVEKMSKSKHNYVGISEKPTEMFGKLMSISDTLMWRYFELLSFRPMSEIERYKSEAEGG
RNPRDFKVMLAQEIVARFHSSADAERALDDFNHRAKGGVPDDIPSVTLAGAPLAIGQLLK
QAGLVPSTSEALRNIEQGGVKIDGATVSDKALKIEAGEFIVQVGKRRFARVTLTA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaccactgattccaacgcctccgccgcgcagcgcttcccgatcaccgacgacgtgaag
agcgcgctcgccatcgccaaacgcggctgcgacgaactgctgatcgaagacgaattcgcg
cagaagctcgcgaggagcgccgccacgggcaagccgctgcgcatcaagctcggtctggat
ccgaccgcgcccgatatccacatcggccatacggtcgtgctgaacaagatgcgccagttg
caggacctcggccatcacgtcatttttctgatcggcgatttcacgtcgctgatcggcgat
ccgtccggccgcaacgcgacgcgcccgccgctcacgcgcgaacagatcgaaatgaacgcg
aagacgtatttcgagcaggcgtcgctcgtgctcgatcgcgaaaaaaccgagattcgctac
aacagcgaatggtcgatgcccctcggcgccgacggcatgatcaagctcgcgtcgcgctat
acggtcgcacgcattctcgagcgcgaggatttcaccaagcgctttcagggcggcgtgccg
atctcgatccacgaattcctgtatccgctgatgcagggttacgactccgtcgcgctgaat
tcggacctcgaactcggcggcacggaccagaagttcaacctgctcgtcggccgtgaattg
cagaagcagtacggccaggagcagcagtgcattctgacgatgccgctgctcgaaggcctc
gacggcgtcgagaagatgtcgaagtcgaagcacaactacgtcggcatcagcgagaagccg
accgagatgttcggcaagctgatgagcatttcggacacgctcatgtggcgttatttcgaa
ctgctgtcgttccgtccgatgagcgagatcgaacgctacaagagcgaagccgaaggcgga
cgcaatccgcgcgacttcaaggtgatgctcgcgcaggaaatcgtcgcgcgcttccattcg
tccgcggacgcggagcgcgcgctcgacgacttcaaccatcgcgcgaagggcggcgtgccg
gacgacattccctcggtgacgctcgccggcgcgccgcttgcgatcggccagttgctcaag
caggcgggcctcgtgccgtcgacgagcgaagcactgcgcaacatcgagcagggcggcgtg
aagatcgacggcgcgaccgtttccgacaaggcgttgaagatcgaagcgggcgagttcatc
gtgcaggtgggcaagcgccgcttcgcgcgcgtgacgttaacggcatga

DBGET integrated database retrieval system