KEGG   Burkholderia sp. YI23: BYI23_A010390Help
Entry
BYI23_A010390     CDS       T01711                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00473  D-Alanine metabolism
byi01100  Metabolic pathways
byi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BYI23_A010390
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BYI23_A010390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:byi01011]
    BYI23_A010390
Enzymes [BR:byi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BYI23_A010390
Peptidoglycan biosynthesis and degradation proteins [BR:byi01011]
 Precursor biosynthesis
  Racemase
   BYI23_A010390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Ice_nucleation
Motif
Other DBs
NCBI-ProteinID: AET88877
UniProt: G8M818
LinkDB All DBs
Position
1:1172918..1173988
Genome map
AA seq 356 aa AA seqDB search
MPRPLSATIHTAALANNLAIARKYAPKSKVWAVVKANAYGHGLARAFPGLRATDGFGLLD
LEEAAKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTAVHCDEQLRMLEMARLSKPVNI
QLKMNSGMNRLGYTPAKFRAAWERARAVHGVGQITLMTHFSDADGPRGIAHQLEAFERGA
EGIAGARSLANSAGVLWHPDAHFDWVRPGIMLYGASPSGVTADIASTGLKPAMTLQSELI
AVQTVDAGSSIGYGSTFTAGESMRIGVVACGYADGYPRIAPEGTPVIVDGVRTKLVGRVS
MDMLTVDLTPCPGAGIGSRVELWGANLPVDDVASAAGTIGYELMCAIAQRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccctatccgcaacgatccacaccgccgcactcgccaacaacctcgccatt
gcgcgcaaatacgcgccgaaatccaaagtctgggctgtcgtcaaggcaaatgcgtatggc
cacgggctcgcccgggcgttccccggactgcgcgcaaccgacggctttggcctactcgac
ctcgaagaagccgcgaagttgcgtgaattgggctgggcggggccgattcttttgctcgaa
ggcttcttccggccgaccgatatcgacgtgatcgaccgctacagcctgaccaccgcggtg
cattgcgacgaacaattacgcatgctcgagatggcgcgcctgtcgaagcccgtcaacatc
cagctcaagatgaacagcggcatgaaccggctcggctacacgccggccaagttccgcgcc
gcctgggagcgcgcccgcgccgtgcacggcgtcggccagatcacgctcatgacccatttt
tccgatgccgacggcccgcgcggcatcgcgcatcagctcgaagcgttcgaacgcggcgcg
gagggcatcgcgggcgcgcgcagcctggccaattcggctggcgtgctgtggcatccggat
gcgcatttcgactgggtgcggcccggcatcatgctctatggcgcatcgccgtcgggcgtg
acggccgatatcgccagcaccggtctcaagcccgccatgacgctccagtccgaactgatc
gcggtgcagacggtcgacgcgggcagcagcatcggctacggctcgacctttacagcgggc
gaatcgatgcgcatcggcgtggtcgcgtgcggctacgcggacggctatccgcgcatcgcg
ccggaaggcacgcccgtgatcgtcgatggcgtgaggacgaagctcgtcggccgcgtgtcg
atggacatgctcaccgtcgatctgacgccgtgcccgggcgcgggcatcggttcgcgcgtc
gagctgtggggcgcgaacctcccggtcgacgacgtcgcgagcgccgccggcacgatcggc
tacgagctcatgtgcgcaatcgcgcagcgcgtgccggtgcgcgcggaataa

DBGET integrated database retrieval system