KEGG   Burkholderia sp. YI23: BYI23_C012020Help
Entry
BYI23_C012020     CDS       T01711                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:byi01007]
    BYI23_C012020
Enzymes [BR:byi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     BYI23_C012020
Amino acid related enzymes [BR:byi01007]
 Aminotransferase (transaminase)
  Class III
   BYI23_C012020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AET93348
LinkDB All DBs
Position
3:complement(1401643..1402944)
Genome map
AA seq 433 aa AA seqDB search
MSLNNDATFWRNARNHLIRYGGTFEPMIIERAQGSFVYDADGRAILDFTSGQMSAVLGHS
HPEIVSVISEYAGKLDHLFSGMLSRPVVDLATRLADITPAGLDRALLLSTGAESNEAAIR
MAKLVTGRYEVVGFAQSWHGMTGHAASATYSAGRKGVGPAAVGSFAIPAPFAYRARFERN
GQYDWLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPEGYMAALKRKCEERGMLL
ILDEAQTGIGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAVVTSAEIEEKAHELGYLF
YTTHVSDPLPAAVGLRVLDVVERDGLVARANVMSARLRRGLLDLMERFDCIGDVRGRGLL
LGVEIVKDRRSKEPADGLGAKITRECMNLGLSMNIVQLPGMGGVFRIAPPLTVSEEEIDL
GLNLLGQAIERSL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgtccctgaacaacgacgcaacgttctggcgcaacgccaggaaccatctcatccgctac
ggcggcacgttcgagccgatgatcatcgagcgcgcgcaaggcagcttcgtctacgacgcc
gacggccgcgcgatcctcgatttcacgtcgggccaaatgagcgcggtgctcggccacagt
catccggaaatcgtgtcggtcatcagcgagtatgcgggcaagctcgaccatcttttcagc
ggaatgctgtcgcggcccgtggtcgatctcgccacgcgtctcgccgatatcacgcccgcc
gggctcgatcgcgcgcttctgctcagcacgggcgcggagtcgaacgaggcggcgatccgc
atggcgaagctcgtcaccggacgctatgaagtggtcggtttcgcgcagtcgtggcacggc
atgacgggccacgccgcgtcggccacgtacagcgccgggcgcaagggcgtgggcccggcg
gcggtcggctcgttcgcgattcccgcgccgttcgcgtaccgcgcgcgcttcgagcgcaac
ggacaatacgactggctcgcggaactggattacgcgttcgatctcatcgaccgtcagtcg
agcggcaatctcgccgcgttcatcgcggagccgattctgagttcaggcggcatcatcgaa
ttgccggaaggctacatggcggcgctcaagcgcaagtgcgaagagcgcggcatgctgctg
attctcgatgaagcgcaaaccggcatcggccgcaccggcacgatgttcgcgtgccagcgc
gacggcgtcacgcccgacattctcacgctgtcgaagacgctcggcgcgggcttgccgctc
gcggcggtggtgacatcggcggaaatcgaagagaaggcgcacgaactcggctatctgttc
tacacgacgcacgtttccgacccgctgcccgccgccgtcggcttgcgcgtgctggacgta
gtcgagcgcgacgggctcgtcgcacgcgcgaacgtgatgagcgcgcgcctgagacgcggc
ctgctcgatctgatggagcgcttcgactgcatcggcgacgtgcgcggacgcggcttgctg
ctgggcgtggaaatcgtcaaggaccgccgctcgaaagagcccgccgacggcctcggcgcg
aagatcacgcgcgagtgcatgaatctcggcttgagcatgaacatcgtgcaattgccgggc
atgggcggcgtgttccgcatcgcgccgccgctgaccgtgagcgaggaagagatcgacctc
gggctgaacctgctcggccaggccatcgagcgatctttataa

DBGET integrated database retrieval system