KEGG   Caballeronia sp. SBC2: SBC2_66410Help
Entry
SBC2_66410        CDS       T06459                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
caba  Caballeronia sp. SBC2
Brite
KEGG Orthology (KO) [BR:caba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SBC2_66410 (ahpF)
Enzymes [BR:caba01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SBC2_66410 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 Glutaredoxin K_oxygenase FAD_oxidored Thi4 DAO FMO-like Thioredoxin_4 NAD_binding_8 AlaDh_PNT_C NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QIE28565
LinkDB All DBs
Position
pSBC2-2:1309636..1311225
Genome map
AA seq 529 aa AA seqDB search
MLEANLKTQLKAYLEKVSRPIEIVASLDNSPKSIELQSLLHEIATLSDRIAVIEKRDDAQ
RKPSFSIGEPGKPTGIRFAGIPMGHEFTSLVLALLQTGGHPVKLDDAVIEQIRALDGDYE
FETYISLSCQNCPEVVQALNVMALINPRIRQVTIDGALFQNEVEQRQIMAVPTVYMNGQV
FGQGRTGVKEILAKLDSSAGARAAKELEKKGVFDVLIVGGGPAGAAAAIYSARKGISTGV
AAERFGGQVLDTLAIENFVSVQATEGPQFATALEQHVKSYDVDIMDVQRAEALVPGKIHE
VRLANGAVLKAKTIVLATGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVSAVTLLEFGTELRADAVLQRKLRSLKNVTIVTQAQTTEVTGDGKKV
NGLSYKDLSSGETKHIELEGVFVQIGLVPNTEWLKGTVELSRHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDYLIRNSETETVEAEVDEAVA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagccaacctcaagactcagttgaaagcgtatctggaaaaggtcagccggccg
atcgagatcgtcgcttcgctcgacaactcgccgaaatccatcgagctgcaaagcctgctg
catgaaatcgccacgctgtcggaccgcattgcggtgatcgaaaagcgcgacgatgcgcaa
cgcaagccgtcgttttccatcggcgaaccgggtaagcccacgggtatccgtttcgcgggc
atcccgatgggccatgaattcacgtcgctggttctggcgctgctccagaccggcggtcat
ccggtcaaactcgacgacgcggtgatcgaacagatccgcgcgctcgacggcgactatgag
tttgaaacgtatatctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcatcaatccgcgtatccgccaggtcaccatcgacggcgcgttgttccag
aatgaagtcgagcaacgccagatcatggccgtccccaccgtctacatgaacggtcaagtg
ttcgggcaaggccgcactggcgtgaaggaaattctcgcgaagctcgatagcagcgctggc
gctcgcgccgcgaaggaactcgaaaagaaaggcgtattcgatgtgctgatcgtcggcggc
ggacctgccggcgcagcggctgccatctactcggcgcgcaagggcatctcgaccggcgtg
gcggctgaacgctttggcggacaagtgctggatacgctcgccatcgaaaacttcgtctcc
gtgcaagcgaccgaaggaccgcagttcgccaccgcgctcgagcagcacgtgaagagctat
gacgttgacatcatggacgtgcagcgcgccgaagcgcttgtgcccggcaagattcacgaa
gtgcgcctggccaacggcgcggtgctgaaagcgaagacgatcgtgcttgccacgggcgct
cgctggcgcgaaatcaacgtgccgggcgagaaggaatatcgcaatcacggcgtggcgtat
tgcccgcattgcgacggcccgctgttcaagggcaagcgtgttgcggtgatcggcggcggc
aattccggcgttgaagcggcaatcgatctggccggactggtcagcgcggtgaccttgctc
gaattcggtacggagttgcgtgccgacgccgtgctgcaacgcaagctgcgcagcttgaag
aacgtgaccatcgtcacgcaggctcagaccacggaagtcaccggcgacggcaagaaggtc
aacggtctttcttacaaggatctgagttcgggcgaaacgaagcatatcgagctggaaggc
gtcttcgttcagatcgggctggtgcctaatacggaatggcttaagggcaccgtcgaattg
tcacgtcacggcgagatcgtggtggatgcgcggggcgcgacgtcggtgccgggcgtgttc
gcggccggcgatgtgaccaccgtgccgttcaagcagatcgtgatcgcggtcggcgaaggg
gccaaagcgtcgcttagcgcgtttgattacctgatccggaattcggagacggaaacggtt
gaagctgaagtcgacgaagcggtggcctga

DBGET integrated database retrieval system