KEGG   Gottschalkia acidurici: Curi_c25660
Entry
Curi_c25660       CDS       T02255                                 

Gene name
yxeO
Definition
(GenBank) amino acid ABC transporter ATP-binding protein YxeO
  KO
K16963  putative S-methylcysteine transport system ATP-binding protein
Organism
cad  Gottschalkia acidurici
Pathway
cad02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cad00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Curi_c25660 (yxeO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cad02000]
    Curi_c25660 (yxeO)
Transporters [BR:cad02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative S-methylcysteine transporter
    Curi_c25660 (yxeO)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 ABC_ATPase AAA_15 AAA_29 RsgA_GTPase AAA_13 AAA_16 AAA_22 AAA_10 AAA_24 AAA_25 AAA_30 MMR_HSR1 ATPase_2 AAA IstB_IS21 AAA_19 AAA_33 RNA_helicase AAA_28 Adeno_IVa2 NACHT AAA_18
Other DBs
NCBI-ProteinID: AFS79561
UniProt: K0B4Q8
LinkDB
Position
complement(2688110..2688862)
AA seq 250 aa
MIEINCLNKSFKDSKVLKDVNLEVKKGEVVAIIGPSGTGKSTLLRCINFLEIPDSGKIRI
KDIEVEVEKITKKEMYEIRGKTSMVFQTYNLFKNKTALENILEHLLIVKKINKKSAIEKA
MDILKTVGLEDKADIYPSKLSGGQQQRVGIGRAMAVEPDVMLFDEPTSALDPELVGEVLD
VIKKLAQKDITMIIVTHEMNFAKNVADKVIFMDDGRIVEQGTPEEIFNYPKNPRTMQFLS
KVISENSHSN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgatagaaattaattgtttaaataaaagctttaaagattcaaaggtcttaaaagatgta
aatttagaagtgaaaaagggtgaagttgttgcaattatcggtccatctggaactggaaag
tctacactattaagatgcattaactttttagagatacctgatagtggaaaaataagaatc
aaagatatagaagtagaagttgaaaagataactaaaaaggagatgtatgaaataagagga
aaaacttctatggtatttcaaacatacaatctctttaaaaataaaactgctttagaaaat
atactagagcacttgttgattgtgaagaaaattaataaaaaatctgctatagaaaaagct
atggatattttaaagaccgttggattagaagataaagcagatatttatccttctaaactt
tcaggaggacaacagcaaagggtaggtataggcagggctatggcagtagaaccagatgtt
atgctatttgacgaaccaacatcagcattagatcctgaacttgtaggagaggtattagat
gttattaaaaagctagcacaaaaggatataacaatgataatagtaactcacgagatgaac
tttgctaagaatgtcgcagataaagttatatttatggatgacggaagaattgtagagcaa
ggtactccagaagaaatatttaattatcctaagaatcctagaactatgcagtttttgagt
aaagtgataagtgaaaattcacatagtaactaa

DBGET integrated database retrieval system