KEGG   Caulobacter sp. K31: Caul_4838Help
Entry
Caul_4838         CDS       T00651                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cak  Caulobacter sp. K31
Pathway
cak00020  Citrate cycle (TCA cycle)
cak00190  Oxidative phosphorylation
cak00650  Butanoate metabolism
cak01100  Metabolic pathways
cak01110  Biosynthesis of secondary metabolites
cak01120  Microbial metabolism in diverse environments
cak01130  Biosynthesis of antibiotics
cak01200  Carbon metabolism
Module
cak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cak_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caul_4838
   00650 Butanoate metabolism
    Caul_4838
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Caul_4838
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Caul_4838
    1.3.5.4  fumarate reductase (quinol)
     Caul_4838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_oxidored Pyr_redox_3 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABZ73958
UniProt: B0T474
LinkDB All DBs
Position
complement(5236105..5237892)
Genome map
AA seq 595 aa AA seqDB search
MSAYKFIDHKFDVVVVGAGGSGLRAALGCAQAGLKTACVTKVFPTRSHTVAAQGGISASL
GNMGQDDWRWHMFDTVKGSDWLGDQDAIEYLTRNAPAAVYELEHWGVPFSRTVDGKIYQR
AFGGMTKNFGEGPIQRTCAAADRTGHAMLHTMYGQSLAHDTEFFIEYFALDLIMEDGVCR
GLTAWKLDDGTLHRFQAQMVILATGGYGRAYFSATSAHTCTGDGNAMALRAGLPLQDMEF
VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSVKDLAPRDMVSRAMTIEIR
EGRGVGPNKDHIFLHLDHLDPKILHERLPGISETAKVFAGVDVTKAPIPVLPTVHYNMGG
IPTNYHGEVVTKSGDNPDQVIPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRAAALRC
AEILKPLATQPELKDSMTDGHLARFDRYRNANGHQPTAALRLEMQKAMQEDAAVFRTGET
LVGGAQRLAVVWEKAKDIKVNDRGMVWNTDLMETLEFDNLIGQAVVTVAGAVNRTESRGA
HAREDFSTRDDANWMKHTLAWLDPSTGQVKIDFRPVHNYTMSKDIDYIPPKQRVY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctacaagttcatcgaccacaagttcgacgtcgtcgtcgtcggcgccggcggt
tcggggctccgcgccgcgctgggctgcgcccaggccgggctgaagaccgcctgcgtgacc
aaggtgttcccgacgcgcagccacacggtcgccgcccagggtgggatctcggcctcgctg
ggcaacatgggccaggacgactggcgctggcacatgttcgacaccgtcaagggctcggac
tggctgggcgaccaggacgccatcgaatatctgacccgcaacgcgccggccgcggtctat
gagctggagcactggggcgtgccgttctcgcgcaccgtggacggcaagatctatcagcgc
gccttcgggggcatgaccaagaacttcggcgaaggcccgatccagcgcacctgcgcggcg
gccgaccgcaccggtcacgccatgctgcacacgatgtacggccagtccctggcccacgac
accgagttcttcatcgagtatttcgccctcgacctgatcatggaagacggcgtctgccgg
ggcctcaccgcctggaagctggacgacggcaccctgcaccggttccaggctcagatggtc
atcctggccaccggcggttacggccgcgcctacttctcggccacctcggcccacacctgc
acgggcgacggcaacgccatggccctgcgcgccggcctgccgctgcaggacatggaattc
gtgcagttccaccccaccggcatctacggcgccggctgcctgatcaccgaaggcgcccgc
ggcgaaggcggctacctgaccaattcggaaggcgagcgcttcatggagcgctatgcgccg
tccgtgaaggacctggccccgcgcgacatggtcagccgggccatgaccatcgagattcgc
gaagggcgcggcgtgggccccaacaaggaccacatcttcctgcacctggaccatctggac
ccgaagatcctgcacgagcgcctgcccggcatctccgagaccgccaaggtcttcgccggc
gttgacgtgaccaaggcgccgatcccggtgctgccgaccgtccactacaacatgggcggc
atcccgacgaactatcacggcgaggtcgtcaccaagtcgggcgacaatcccgaccaggtg
atccccggcctgatggccgtgggcgaggcggcctgcgtctcggtgcacggcgccaaccgc
ctgggctccaacagcctgatcgacctggtggtgttcggtcgcgccgcggccctgcgctgc
gccgagattctcaagcccctggccacccagccggagctgaaggacagcatgaccgacggc
cacctggcgcgcttcgaccgctaccgcaacgccaatggccatcagccgaccgccgccctg
cgcctcgaaatgcagaaggccatgcaggaagacgccgcggtgttccgcacgggcgaaacc
ctggtcggcggcgcccagcgcctggccgtggtctgggaaaaggccaaggacatcaaggtc
aacgaccgcgggatggtgtggaacaccgacctgatggagaccctggagttcgacaacctg
atcggccaggccgtcgtgaccgtggccggggcggtcaaccgcaccgaaagccgcggcgcc
cacgcccgcgaggacttctccacgcgggacgacgccaactggatgaagcacaccctggcc
tggctcgacccgtcgaccggccaggtgaagatcgatttccggccggtgcacaactacacc
atgtccaaggacatcgactacatcccgcccaagcagcgcgtgtactga

DBGET integrated database retrieval system