KEGG   Caulobacter sp. K31: Caul_4879Help
Entry
Caul_4879         CDS       T00651                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cak  Caulobacter sp. K31
Brite
KEGG Orthology (KO) [BR:cak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Caul_4879
Enzymes [BR:cak01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Caul_4879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 DAO AlaDh_PNT_C NAD_binding_7 Glutaredoxin Thi4 K_oxygenase FMO-like DUF2703 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABZ73999
UniProt: B0T553
LinkDB All DBs
Position
complement(5274122..5275711)
Genome map
AA seq 529 aa AA seqDB search
MLDDGLKTQLKAYLQNLRQPIELVASLGEGAGSKDMLALLEDVAATSDKVGLSLAGDDAR
KPSFAITRASGDAKVRFAGLPLGHEFTSLVLALLHVGGHPPKFDAEVLDQVRALEGEFRF
ETYFSQTCQNCPDVVQALNTMAALNPNISHVAIDGALFQQEVEDRQIMAVPTILLNGQPF
GQGRMSLEQILAKLDTGATAREAEKIKAKDAYDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLATALEQHVKDYDVDIMNLQKAVGLVPAKIPGG
LIEVKLENGASLTSRTVVLATGARWRHINVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDGELRADAVLQRKLASLPNVRIVTSALTTEIHGDG
TRVNGLTYKDRNQDSLHRVDLEGVFVQIGLVPNTEWLKDTGVALTNRGEIEVDYRGATSL
PGVFAAGDATTTPYKQIVIAMGEGAKAALSSFDFLIRQEPMVPAEQVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgatggtctgaagacccagctgaaagcctatctgcagaacctgcgtcagccg
atcgaactggtcgcctcgctgggcgagggcgcgggatccaaggacatgctggcgctgctc
gaggacgtggcggcgacctccgacaaggtcggcctgagcctggccggcgacgacgcccgc
aagccgtccttcgccatcacccgcgccagcggcgacgccaaggtccgcttcgccggcctg
cccctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggccacccg
cccaagttcgacgccgaggtcctcgaccaggtccgcgccctggagggcgagttccgcttc
gagacctatttctcgcagacctgccagaactgcccggacgtggtccaggcgctcaacacc
atggcggccctgaaccccaacatcagccacgtcgccatcgacggcgcgctgttccagcaa
gaggtcgaagaccgccagatcatggccgtgccgaccatcctgctgaacggccagccgttc
ggccagggccggatgagcctggagcagatcctggccaagctcgacaccggcgcgacggcc
cgcgaggccgagaagatcaaggccaaggacgcctatgacgttcttgttgtcggtggcggc
cccgcgggcgccgcggcggcgatctacgccgcccgcaagggcatccgcaccggcgtcgcc
gccgaacgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtc
tcccacaccgaaggccccaagctggcgacggcgctggagcagcacgtcaaggactacgac
gtcgacatcatgaacctgcagaaggccgtcggcctggttccggccaagatcccgggcgga
ctgatcgaggtcaagctggagaacggcgccagcttgacgtcgcggaccgtggtcctggcc
accggcgcccgctggcggcacatcaacgtccccggcgaggacgagtaccgcaacaagggc
gtggcctattgcccgcactgtgacggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaatagcggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtg
accctgatcgagttcgatggcgagttgcgcgccgacgccgtgctgcagcgcaagctggcc
agcctgcccaacgtgcggatcgtcacctcggccctgaccaccgagatccacggcgacggg
acccgcgtcaacggcctgacctacaaggaccgcaaccaggactccctgcaccgcgtggac
ctggaaggcgtgttcgtgcagatcggcctggtccccaacaccgagtggctcaaggacacc
ggggtggccctgaccaatcgcggcgagatcgaggtcgactatcgcggcgcgacttcgctg
ccgggcgtgttcgcggccggcgacgcgaccaccacgccctacaagcagatcgtcatcgcc
atgggcgaaggcgcgaaggcggccctgtcgtccttcgacttcctgatccgccaggagccg
atggtcccggccgagcaggtcgcggcctga

DBGET integrated database retrieval system