KEGG   Cryobacterium arcticum: PA27867_0891Help
Entry
PA27867_0891      CDS       T04435                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
cart  Cryobacterium arcticum
Brite
KEGG Orthology (KO) [BR:cart00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cart03016]
    PA27867_0891
Enzymes [BR:cart01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     PA27867_0891
Transfer RNA biogenesis [BR:cart03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    PA27867_0891
 Prokaryotic type
    PA27867_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2 TruB-C_2
Motif
Other DBs
NCBI-ProteinID: ANP71858
UniProt: A0A1B1BH32
LinkDB All DBs
Position
1:1015821..1016825
Genome map
AA seq 334 aa AA seqDB search
MNAPRRKPASTTSGLVLIDKPQGWTSHDAVARTRRLAGTRKVGHAGTLDPMATGLLILGI
NSSTRLLTYVVGLDKEYLATIRLGAATTTDDAEGEELTRAPAEAVAAVSAESIADGIAAL
TGAISQRPSAVSAIKVDGKRAYARVRAGEDVELPARPVTVSEFELVSSTAADGFLDLEVR
VVCSSGTYIRALARDLGDALGVGGHLTSLRRTRIGPFGIMDADPLDVLDVGRALIGPADA
ASRLFERFDLDAQQAIDLGHGKRIDAPAGAGDAGPVAAVDPAGRLIGLVEYRDGRAKSIV
NFPPDEQPAPAAEPAADSVPEPVPESPTESEDAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccccgagacgcaagcctgccagcacgaccagcggcctcgtactgatcgacaag
ccccagggctggaccagccacgatgccgtcgcccgcacccgccgtttggccggtacgcgc
aaggtcggccacgccggcaccctcgaccccatggccaccggcctgctgatcctcggcatc
aacagctccacccggctgctcacctacgtggtcgggctcgacaaggagtatctggccacc
atccgcctgggtgctgccacgaccaccgacgacgccgagggggaggagctgacgcgggcc
cccgccgaggccgttgccgccgtgagcgcggaatcgatcgccgacggcatcgccgccctc
accggcgcgatcagccagcggcccagcgccgtgagcgccatcaaggttgacggcaagcgc
gcctacgcccgcgtgcgtgccggcgaggacgtggagctgcccgcccgaccggtcaccgtg
agcgagttcgagctcgtgtccagcaccgccgccgacggtttcctcgacctcgaggttcgc
gtggtgtgctcctcgggcacctacatccgcgcactggcccgcgacctcggcgacgccctg
ggcgtgggtggtcacctcacgagcctccgccgcacgcgcatcggcccgttcggcatcatg
gacgccgacccactcgacgtgctcgatgtgggccgggccctgatcgggccggcggatgcg
gcgtcccgcctcttcgagaggttcgacctcgacgcccagcaggccatcgacctcggccac
ggcaagcgcatcgatgcgccggccggagcgggcgatgccggcccggtcgcggctgtggac
ccggccggccggctgatcgggctcgtcgaataccgcgacgggcgcgccaagtcgatcgtg
aacttcccgccggacgaacagccggcgcccgctgccgagcccgccgccgactcggtgccc
gagcccgtccccgagtcgcccacagaatccgaggacgccaagtga

DBGET integrated database retrieval system