KEGG   Comamonadaceae bacterium B1: SMCB_2140Help
Entry
SMCB_2140         CDS       T03627                                 

Gene name
tufA
Definition
(GenBank) GTPase - translation elongation factors
  KO
K02358  elongation factor Tu
Organism
cbab  Comamonadaceae bacterium B1
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cbab03012]
    SMCB_2140 (tufA)
   03029 Mitochondrial biogenesis [BR:cbab03029]
    SMCB_2140 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbab04147]
    SMCB_2140 (tufA)
Translation factors [BR:cbab03012]
 Eukaryotic Type
  Elongation factors
   SMCB_2140 (tufA)
 Prokaryotic Type
   SMCB_2140 (tufA)
Mitochondrial biogenesis [BR:cbab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SMCB_2140 (tufA)
Exosome [BR:cbab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SMCB_2140 (tufA)
  Exosomal proteins of breast cancer cells
   SMCB_2140 (tufA)
  Exosomal proteins of colorectal cancer cells
   SMCB_2140 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: BAO84368
UniProt: A0A060NXY6
LinkDB All DBs
Position
complement(2312480..2313670)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFQRTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGQAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYDFPGDQTPIVHGSAKLALE
GDKGPLGEQAIMKLADALDTYIPQPERAVDGAFLMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIATTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGS
IKPHTHFTGEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPEGKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaaattccagcggaccaagccgcacgtcaacgtgggcaccatcggtcac
gtggaccacggcaaaaccacgctcacggcggccatcaccaccgtgctggcagccaagttt
ggcggacaggccaaggcctacgaccagatcgacgccgcccctgaagaaaaagcgcgcggc
atcaccatcaacaccgcgcacgtcgaatacgagaccgccaaccgccactacgcccacgtc
gactgccccggccacgccgactacgtcaaaaacatgatcaccggtgccgcgcagatggac
ggcgccattctggtctgctccgccgccgacggcccgatgccgcaaacccgcgagcacatc
ctgctcgcgcgccaagtcggcgtgccctacatcatcgtcttcctcaacaagtgcgacatg
gtggacgacgccgagctgctcgaactcgtcgagatggaagtgcgcgagctgctcgacaaa
tacgacttccccggcgaccagaccccgatcgtgcacggctcggccaaactcgccctcgaa
ggcgacaaaggcccgctgggcgaacaagccatcatgaaactggccgacgccctcgacacc
tacatcccgcagcccgaacgcgccgtcgatggcgccttcctcatgcccgttgaagacgtg
ttctccatctccggccgcggcaccgtggtcaccgggcgcatcgagcgcggcatcatcaaa
gtcggcgaagagatcgaaatcgtcggcatcgccaccacccagaaaaccacctgcaccggc
gtcgagatgttccgcaaactgctcgaccaaggccaagccggcgacaacgtcggcatcctg
ctgcgtggcaccaagcgcgaagacgtgcagcgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcaccggtgaggtctatgtgctgagcaaagacgaaggcggg
cgccacaccccgttcttcaacaactaccggccgcagttctacttccgcaccacggatgta
accggatcgatcgagctgcccgaaggcaaagagatggtcatgccgggcgacaacgtcagc
atcaccgtcaaactgatcgccccgatcgccatggaagaaggcctgcgctttgccatccgc
gaaggcggccgcaccgtgggcgccggcgtggtggcgaagattttggattga

DBGET integrated database retrieval system