KEGG   Cellulophaga baltica NN016038: M667_16305
Entry
M667_16305        CDS       T03562                                 

Definition
(GenBank) Iota-carrageenase
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
cbal  Cellulophaga baltica NN016038
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M667_16305
Enzymes [BR:cbal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     M667_16305
SSDB
Motif
Pfam: Pectate_lyase_3
Other DBs
NCBI-ProteinID: AIY14611
LinkDB
Position
3767586..3769061
AA seq 491 aa
MKVQLKHFYATTMALLAMGCSKEIEENQNAEPLETATELQVSDGRFYRPPSNAVLSNVKN
LVTDFNVNNRDNNDDSAKLNTAIANLSSSGGKLIIPAGKYYLNKIRMQSNVHLEIDKGAT
IYPTRGIAANSNHRIFDFASKTGEKIENVSIIGKGGNFTVDLRGNSSKNLIVADVGNVEN
FKISNFDIKDEKTVFASILISFTGKPGDSWPHKGIIQNVNQTNAHTGYGLIQAYAADNIL
FKNLKCKGGVTLRLETDNLAMKAANRGGVRDIFATKISNTNGLTPVMFSPHFMENGKVTI
DDVTAIGCAYAVRVEHGFIEIFDKENRANGQAYKNYIEGILGAGSVSELYKRNNGRTWAV
RIANDFSERAYNHSNPAVNGIKPGSFKNSTVKNVKVTYKNTGAKLKHLFLPYLPCSEWSK
LCKPGPTGFEYNGPSLGVSIDNTKRDNSLGNYNVQVITSKVQGFPNNYILNVKHNTAKVC
NNGIGTIASCN
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaaagtacaattaaaacatttttatgcaacaactatggctttattagctatgggatgt
tctaaagagattgaagaaaatcagaatgcagaaccattagaaacagccacggaactgcag
gtttcagacggtagattctacagaccacctagtaatgcagtactatcaaatgttaaaaat
ttggtaacagattttaatgtaaataatagagataataatgatgatagcgccaaattaaat
acggcaatagctaatttatcttccagtggtggaaaattgatcataccggcaggtaaatac
tatttaaataaaattagaatgcaatctaatgtacatttagaaatagataaaggagctacc
atttacccaacaagaggcattgcggccaacagcaatcatagaatttttgattttgccagt
aaaacaggagaaaaaattgagaatgtcagtatcattggtaaaggaggaaattttactgtg
gacttaaggggcaattcttcaaaaaatctaatagtggctgatgtaggaaatgtagaaaat
tttaaaatctctaattttgatattaaggatgagaaaacagtatttgcctctattttaata
agttttactggtaaacctggtgattcttggccacataaaggtattattcaaaatgttaat
caaacaaatgcacacactggatatggactaatacaagcctatgctgcagataatatttta
ttcaaaaatctaaaatgtaaaggaggagtaacactacgtcttgagactgataacttagca
atgaaagctgctaacagaggtggcgtaagagatatttttgctacaaaaattagtaataca
aatggtttaacccctgtgatgttttctcctcattttatggaaaatggaaaagtaactata
gatgatgttacggcaattggttgtgcctatgcagtacgcgtagaacatggatttattgaa
atttttgataaagaaaatagagcaaacggacaagcttataaaaattatatagagggtatt
ttaggcgctggttcagtatcagaattatacaaacgtaataatggtagaacttgggcagta
cgtatcgctaacgattttagtgaaagagcctacaaccactctaacccggcggtaaacggc
attaaaccaggaagttttaaaaactctaccgtaaaaaatgtgaaagtaacttacaaaaat
acaggagctaaattaaagcatttatttttaccatatctaccttgctcagaatggtctaaa
ttatgtaaaccgggacctactggttttgagtataatggcccttcgttaggagtttctata
gataatacaaaaagagacaatagtttgggtaattataatgtacaagtaattacatctaaa
gtacaaggctttcctaacaactatattttaaatgtaaaacacaacactgcaaaagtctgt
aataacggtattggtaccattgcttcttgcaattaa

DBGET integrated database retrieval system