KEGG   Clostridiales bacterium 70B-A: PATL70BA_3390Help
Entry
PATL70BA_3390     CDS       T05737                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase (subunit B)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00970  Aminoacyl-tRNA biosynthesis
cbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PATL70BA_3390 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cbar03029]
    PATL70BA_3390 (gatB)
Enzymes [BR:cbar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PATL70BA_3390 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PATL70BA_3390 (gatB)
Mitochondrial biogenesis [BR:cbar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PATL70BA_3390 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: VDN49321
UniProt: A0A3P7Q1W0
LinkDB All DBs
Position
1:3458307..3459746
Genome map
AA seq 479 aa AA seqDB search
MGYEDYEIVMGLEVHSELKTNTKIFCDCKNEFGGEPNTHCCPICTGMPGTLPVLNGKVVE
YAIKAGLATNCKINQFSKQDRKNYFYPDLPKAYQVSQFDLPLCYEGEVEIEVEGEIRKIG
ITRIHIEEDAGKLNHEIGGTLVDYNRCGIPLIEIVSEPDFRSPVEVGIYMEKLRTILLYA
DVSDCKMNEGSLRCDVNLSVRKKGEKTLGTRTEMKNINSFSFAVKAAEYEAKRQIKVLES
GGTIIQETRRWDEAKGITISMRTKEEAHDYRYFPEPDLMPIITTDEQILKWKASLPVMPD
VRKANYIKDYGLGSKEAGILVASRKIADFFEAGASCSKNPKAVANWIISEVYSRLNEDEK
EQGPMPIKGEDLGTLVNLIEEGTISGKMAKTVFEKMWQTGKSPATIVDEEGLKQNSDEDA
LRTIASDVLNNNEKIVADYLGGKEAAIQSLMGQMMKATKGKANPKMVIDLLKELLEAMR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgaagattatgaaatagtcatgggtctagaagttcactcagaacttaagacc
aatacaaagatattttgcgattgcaagaatgaattcggtggtgaacccaatacccattgt
tgccctatttgtacagggatgccgggaacgctacctgtacttaacggaaaagttgtggaa
tatgcgattaaggcaggtcttgcaaccaattgtaagattaaccaatttagcaaacaagat
agaaaaaactatttctatccggatttgccgaaggcctatcaagtttctcaatttgattta
cctttatgttatgagggagaagttgaaattgaagttgagggagagattaggaaaatcggt
atcacaagaattcatatagaagaagatgccggaaagctcaatcatgagattggtggaacc
ttggtggattataatcgttgtggcattcctttaattgagattgtgtcagaaccggacttt
agatcaccggttgaagtgggcatatatatggaaaagcttagaaccatcttactttatgcg
gatgtatccgattgtaaaatgaacgaaggttctctaaggtgtgatgtgaatctctccgtt
cgtaaaaaaggtgagaaaacactgggcacaagaacagagatgaaaaacatcaactccttt
agttttgctgttaaggctgctgagtacgaagccaaacgacaaatcaaagttctggaatcc
ggaggtaccattattcaggaaaccagacgttgggatgaggcaaaaggcattaccatctct
atgcgtacaaaagaagaagcccatgattacagatatttccctgaaccggatttgatgccg
attattactaccgatgaacagattcttaaatggaaagcatctcttccagtaatgccggat
gtaagaaaagcaaattatataaaagattacggattgggaagcaaagaagcgggtatccta
gtggcatcaagaaaaatagctgatttctttgaagccggtgccagttgctcgaaaaatcca
aaagcggtcgccaattggattatctctgaagtctacagtcgtttaaatgaagatgaaaaa
gaacaaggtcctatgcccataaagggagaagaccttggtaccttggtcaatctgattgaa
gaaggtacaattagtgggaagatggctaagactgtttttgaaaaaatgtggcaaaccggt
aaatctccggcgaccattgttgatgaagaaggattgaagcaaaacagtgatgaagacgct
cttagaactatagcttcagatgtgcttaataataatgaaaaaatagttgccgattatttg
ggtggtaaagaagctgctattcagtcacttatggggcaaatgatgaaagccactaaaggt
aaggctaaccctaagatggttattgacttattaaaagaattactagaagcaatgcggtaa

DBGET integrated database retrieval system