KEGG   Clostridium botulinum B1 Okra: CLD_2359Help
Entry
CLD_2359          CDS       T00671                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLD_2359
Enzymes [BR:cbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLD_2359
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLD_2359
    1.1.1.-  
     CLD_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA 2-Hacid_dh_C ADH_zinc_N_2 Pyr_redox ADH_N_assoc Shikimate_DH Pyr_redox_3 NAD_binding_7 GP68 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACA46881
UniProt: B1IGW8
LinkDB All DBs
Position
complement(2412346..2413419)
Genome map
AA seq 357 aa AA seqDB search
MKAALWYEKKDVRVEEIEEPKVVEGSVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHALS
GTTAPVVLGHEFSGEIIELGQGVTKFNIGDRVIVEPIVACGKCPACMEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFVHKIPDEMSYEDAALVEPMAVALHSVRIANFNTGDTALVLG
AGPIGLATIECLKAAGARLIVVLQRKSIRQKYAKRAGADVVLDPNEVNIPEEVKKLTDGL
GVDVAFETTGAKIGFDTGIESLKFEGTMVITSIWEKDTNFNPNVLVFTEKKIVGTLAYRH
EFPATMALMKDGRIKTDGYITKKIALDDIVEEGFGALTGPEKKKHVKIIVTPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgaaaaaaaagatgtaagagtggaagaaattgaagaacca
aaggtagtagaaggatctgtaaaaattaaagtaaaatggtgtggaatatgtggttccgat
ttacatgaatatttaggaggccctatatttattccagtaggacaacctcatgcgttaagt
ggaacaacagcaccagtagttttaggacacgaattttcaggagaaataatagaattagga
caaggtgtaacaaaatttaatattggagatagggtaattgttgaacctatagtagcttgt
ggaaaatgtccagcctgtatggaagggaaatataatctttgttcatctttaggttttcat
ggactttgtggaagtggcggtggacttgcagaatatactgtatttccagaggaatttgtt
cataaaattccagatgaaatgtcctatgaggatgcggccttagtagaaccaatggcagta
gcacttcattctgtaagaatagctaattttaatacaggagatacagctttagtattaggt
gcaggaccaataggtcttgccacaatagaatgcttaaaagcagctggagcaagactcata
gtagttttacaaagaaaatctataagacaaaaatatgcaaaaagagcaggggcagatgta
gttttagatcctaatgaagttaatataccagaagaagttaaaaaacttacagatgggtta
ggtgtagatgtagcctttgaaaccacaggagctaagataggatttgatactggtattgaa
agcttaaaatttgaaggtacaatggttataactagtatatgggaaaaggatacaaacttt
aatccgaatgtattagtatttactgaaaagaaaattgtaggaactttagcatatagacat
gaattcccagccactatggcgttaatgaaggatggaagaataaaaacagatggatatatt
acaaagaaaatagctttagatgatatagtagaagaaggatttggggctttaactggaccg
gaaaagaaaaaacatgtaaaaattattgtaactccagataaatcacttttataa

DBGET integrated database retrieval system