KEGG   Clostridium botulinum A2: CLM_1874Help
Entry
CLM_1874          CDS       T00883                                 

Gene name
acoC
Definition
(GenBank) TPP-dependent acetoin dehydrogenase complex, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cby  Clostridium botulinum A2
Pathway
cby00010  Glycolysis / Gluconeogenesis
cby00020  Citrate cycle (TCA cycle)
cby00620  Pyruvate metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
cby01120  Microbial metabolism in diverse environments
cby01130  Biosynthesis of antibiotics
cby01200  Carbon metabolism
Module
cby_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLM_1874 (acoC)
   00020 Citrate cycle (TCA cycle)
    CLM_1874 (acoC)
   00620 Pyruvate metabolism
    CLM_1874 (acoC)
Enzymes [BR:cby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLM_1874 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACO86478
UniProt: C1FN99
LinkDB All DBs
Position
1914485..1915795
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKKEGDTIKVGETLFDVTTDKLTNNVEAKADGIVRKIL
VDEGTVVECLKPVAIIGDKDEDISNLLKESLQDSKENEVEKEVKESKEEIKDNRKIKKGE
RTKISPIAKRLAKENDVDIQLLDGTGPEGRIVLKDVESYIENNKNNIKTSPVAEKMAKDL
GVNLEDIKKDGRIMKDDILEFIQKSTPSVGEDLMDRRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDMTNLKRLKEQIKDEWKVTYTDLLVKIVSKVLIQYPLVNCSIEGDEMIFRNYS
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNGLTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGVNMITNTPVVENGEIVIKPLMSLSLTADHRAVDGAVAAQF
LKAVKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagctagaggttatgccaaagctgggattaactatgacagagggtgaactagtt
aaatggcataaaaaagaaggagatactataaaggtaggagagaccttatttgatgtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaagatttta
gtagatgaaggtacagtagttgaatgtttgaaaccagtagccataattggagataaagat
gaggatatatcaaatctattaaaggaatctttacaagatagtaaggaaaatgaagtagaa
aaagaagttaaagaatctaaggaagagataaaagataataggaaaattaaaaaaggagaa
agaacaaagatatccccaatagcaaaaagacttgcaaaggaaaatgatgtggatattcaa
ctattagatggaacagggcctgaaggaagaatagttttaaaagatgtagaatcatatata
gaaaataataagaataatattaaaacttctccagtagcagagaagatggctaaagattta
ggcgttaatttagaagatataaagaaagacggaagaataatgaaagatgatatattagaa
tttatccaaaaatctactccttctgtaggagaagatttaatggatagaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgacattgaagtggacatgactaatttaaaaaggttaaaggaacaaattaaa
gatgaatggaaagttacttatacagatttattagtaaaaatagtttctaaagtactcatt
caatatcctttagttaattgctcaatagaaggagatgaaatgatttttagaaattattca
aatattggggtagcagtggctttagaggaaggccttgtggtaccagtggttaaatatgca
aaccaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagctaaa
aataatggacttactgaagaaaatagtactggaggaacttttactataactaatcttggt
atgtttggtataaagtctttttctccaattataaatcagcctgaagtagctatattaggt
gtgaatatgataactaatactccagttgtagagaatggagaaatagtgataaaacctctt
atgagtttatctcttactgcagaccatagggcggtagatggtgctgtagcggctcaattc
ttaaaagcagttaaaaaatatatggaaaagccagagttgcttatattgtag

DBGET integrated database retrieval system