KEGG   Cyanistes caeruleus (blue tit): 111928191
Entry
111928191         CDS       T05602                                 

Gene name
ZBTB49
Definition
(RefSeq) zinc finger and BTB domain-containing protein 49
Organism
ccae  Cyanistes caeruleus (blue tit)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 BTB zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met zf-C2H2_11 GAGA zf-Di19 zf-C2HC_2 Zn-ribbon_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 111928191
NCBI-ProteinID: XP_023781270
LinkDB
Position
4
AA seq 765 aa
MDTVASHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRTLFQNSSGQ
KNDVFHLDIKNVGGIGQILDFMYTSHLDLSQDNVQAMLDIAQCLQVQNVLNICHTFLKSS
TAVEQAASMPCNSVFSLQNALGSDTGCAGDGYGTNLLPECSADTQTNKVLAEHHPHASQS
VNLHTPSGDGQKPPQDSLDGNCTELPFKQPSYYYKLRNFYSKQFYKQNACSDHERGAEPS
FSYNTSTEINTVENNSCAVNHSECILETTDHLPSNFLVQSASEAAPDQNAESTVLQPTRQ
MRLKKAIHLKKLNFLRSQKSAEQPPEPQRDDSRVTEVVEPVNESITDTTHVRVTDEKEAE
DLVNSEHFEQTVEVERSQGPLEQEGQSQTLQSQKQYTCELCGKAFKHPSNLELHKRSHTG
EKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPH
LCDICGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSA
CGKCFAGSGDLRRHVRTHTGEKPYTCETCNKCFTRSAVLRRHKKMHCRASEEGPNALEEF
TQGIETPDLDKSQSSDSFGPEMSVTLLPVSVKFPLHPAGNSAEFDSSADSYCKLRSMIQH
HDSANAEKLSVDSAKVLKGQAQPAPPPPYAYSDVDVAAAEEPLQSGGVAMIRSSAAGLDG
HCSGEALGSRASSAAYKSNEGPFFSSMTLWGLAMKTLQNENELEQ
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggacactgttgctagccatagctgtcatcttctccagcagctacatgaacagcgcatt
caggggcttctctgtgactgcatgctggtggtgaagggtgtctgcttcaaagcacacaaa
aatgtattagctgctttcagtcaatatttcaggacccttttccagaattcttcaggccag
aagaatgatgtgtttcacttggacattaaaaatgtaggtggcataggccagatcctggac
ttcatgtacacctcccacctggatcttagtcaggacaatgtacaagctatgctggacatt
gcacagtgcctccaagtgcaaaatgtgctgaacatttgccacacctttttaaagtcttcc
acagctgtggagcaggcagccagcatgccgtgtaatagtgtattttcactgcagaatgct
ttgggttcagataccggctgtgccggtgacggctatgggacaaacctattgcctgagtgc
tcagctgacacacaaactaacaaagtcttggctgagcaccacccacatgcatcacagtct
gttaatctgcacaccccatcaggtgatggacagaaaccaccacaagattccttagatggc
aactgcacagagcttccatttaaacagccaagttactactataaactacgcaacttttac
agcaaacagttctataaacaaaacgcttgctctgatcacgagagaggagcagaaccatcc
ttttcttacaacacatccacagaaataaacacagtggagaataattcttgcgctgtcaat
cactctgagtgtattctggaaaccactgatcatttaccatcaaactttctggttcagtct
gcaagtgaagctgctccagaccaaaatgcagagagcacagttctgcagcccaccagacaa
atgcggctgaaaaaggcaatacacctcaaaaagctaaattttctaagatctcagaaatct
gcagagcagccgcctgagccccaaagagatgacagtagagtgacagaagtagttgaacct
gtaaatgaaagtatcacagacacgacacacgttagagttactgatgaaaaagaagctgaa
gatttagtgaattcagagcattttgaacaaactgttgaagtggaaagatctcaaggtcct
ttggaacaagaaggacaatcacagactcttcagtcacagaaacaatatacttgtgagtta
tgtgggaaggctttcaaacatccaagcaatttggagctacataaaaggtctcatacaggt
gagaaaccttttgaatgtaacatttgtgggaaacacttctcacaggcaggtaatctccag
acacatttacgacgacattctggtgagaagccatacatttgtgaaatctgtgggaagaga
tttgctgcttctggtgatgttcagcgtcatataattattcattctggagaaaaacctcac
ctgtgtgatatctgtggcagaggtttcagtaacttcagtaatttaaaagagcacaaaaag
acgcatacagcagataaagtattcacctgtgatgaatgtgggaagtcatttaatatgcaa
cgaaaattggtaaagcacaggataagacacactggagagagaccatacagctgttcagct
tgtgggaaatgttttgcaggctctggtgacctgcggaggcacgtgaggactcacactggg
gagaagccctacacctgtgagacgtgtaacaagtgcttcactcgctcggccgtgctgcgg
cggcacaagaagatgcactgcagagcctctgaggaggggcccaacgcactcgaggaattt
actcaagggattgaaacgcccgacctggacaagtcccagagctctgactcttttggccca
gaaatgtcagttacattgttaccggtgtctgttaaatttccccttcatccagctggaaac
tcggctgaatttgacagttccgcggattcttactgtaagctgcggtcaatgatccagcac
cacgactcggcaaacgcggagaaactcagcgtggattccgctaaagtcctgaaaggccag
gcacagccggctccaccgccgccctatgcttactcagacgtcgatgtggccgcagcagag
gagcccctgcagtcgggtggcgttgccatgatccgctcctccgcggcgggcctggacggg
cactgcagcggcgaggccctgggcagccgggcctcctctgccgcttacaagagcaacgag
ggccccttcttctccagcatgaccctctggggcttggccatgaagaccttgcaaaacgaa
aatgagttggagcaatga

DBGET integrated database retrieval system