KEGG   Cyanistes caeruleus (blue tit): 111936423
Entry
111936423         CDS       T05602                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00010  Glycolysis / Gluconeogenesis
ccae00053  Ascorbate and aldarate metabolism
ccae00071  Fatty acid degradation
ccae00280  Valine, leucine and isoleucine degradation
ccae00310  Lysine degradation
ccae00330  Arginine and proline metabolism
ccae00340  Histidine metabolism
ccae00380  Tryptophan metabolism
ccae00410  beta-Alanine metabolism
ccae00561  Glycerolipid metabolism
ccae00620  Pyruvate metabolism
ccae00770  Pantothenate and CoA biosynthesis
ccae01100  Metabolic pathways
Module
ccae_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111936423 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    111936423 (ALDH2)
   00620 Pyruvate metabolism
    111936423 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111936423 (ALDH2)
   00561 Glycerolipid metabolism
    111936423 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111936423 (ALDH2)
   00310 Lysine degradation
    111936423 (ALDH2)
   00330 Arginine and proline metabolism
    111936423 (ALDH2)
   00340 Histidine metabolism
    111936423 (ALDH2)
   00380 Tryptophan metabolism
    111936423 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111936423 (ALDH2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    111936423 (ALDH2)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111936423 (ALDH2)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 111936423
NCBI-ProteinID: XP_023793130
LinkDB
Position
15
AA seq 520 aa
MLRAVLRGSRLCPALLRAPFSAAAASPIPAPNPRPDIAFNKIFINNEWHDAVSKKTFPSI
NPATGEVICQVAEGDKADVDKAVKAAKAAFQLGSPWRRMDASHRGKLLNRLADLIERDRA
YLAALETLDNGKPYAISYLVDLDMVVKCLRYFAGWSDKFHGKTIPLDGDFFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLSALYVANLIKEAGFPPGVVNI
IPGYGPTAGAAISSHMDIDKVAFTGSTEVGHLIQKAAAESNLKRVTLELGGKSPNIIMSD
ADMDWAVDQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSVEKAKARVVGNPFDFKTE
QGPQVDEEQFKKILGYISTGQREGAKLLCGGNPAADRGYFIQPTVFGDVQDNMTIAREEI
FGPVMQILKFKTIEEVIERANDSKYGLAAAVFTKDLDKANFVSQSLRAGTVWINCYDVFG
AQAPFGGYKASGNGRELGEYGLEAYVEVKNVTIKIPQKNS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgctgcgggcggtgctgcgcggctcccggctctgcccggccctgctccgggctcccttc
tcggccgccgccgcctcccccatcccggcgcccaacccgcgccccgacatcgcctttaac
aagattttcataaataacgaatggcacgatgcagtcagcaagaaaaccttcccctccatc
aacccagccacgggagaagtcatctgccaggtggctgagggcgataaggcagatgtggac
aaggcggtgaaggcagccaaggcagcattccagctgggctctccctggaggaggatggat
gcatctcaccgcgggaagctgctgaaccgtctggctgacctgatcgagagggaccgcgcc
tacctggccgccctggaaactctggataatggcaaaccctacgccatctcctacctggtg
gatttggacatggtggtcaaatgtctcagatactttgcaggctggtctgataaattccac
gggaaaaccatccccttagacggagacttcttctgctacacaagacatgagccggtggga
gtctgtggacaaatcatcccgtggaacttccccctgttgatgcaagcatggaaactgggg
cctgccctggccactgggaatgtggttgtgatgaaggtggcagagcaaacccccctgagt
gctctctacgtggccaatctgatcaaagaggctggattccccccgggcgtggtgaacatc
atccctggctatggccccacggcaggagctgccatctcctcacacatggacattgacaaa
gtggccttcaccggctccacggaggtcggacacctgatccaaaaggctgcagcagagagt
aacctcaagagggtgaccctggagcttggagggaagagcccaaatatcatcatgtctgat
gcagacatggactgggctgtggatcaagcccactttgccctgttcttcaaccaagggcag
tgctgctgtgccgggtccaggacctacgtgcaggaggacatttacaacgagtttgtggag
aggagcgtggagaaggccaaggccagggtggttgggaacccctttgacttcaaaactgag
cagggccctcaggtggatgaggagcagttcaagaagatcctgggctacatcagcactggg
cagcgggagggagccaagctgctgtgtggtggcaaccctgctgcagacaggggctacttc
atccagcccactgtctttggggatgtgcaggacaacatgaccattgccagggaggagatc
tttgggccggtcatgcagatcctgaaattcaaaaccatcgaggaggtcattgagagagcc
aatgactccaagtacggcctggcagccgcggtgttcaccaaggacctggacaaagccaac
tttgtgtcgcagagcctgcgggctgggacggtctggataaactgctacgatgtgtttggt
gcccaggctccctttggtggctacaaagcctctgggaacgggcgggagctgggagagtac
ggcctggaggcttatgtggaggtgaaaaacgtgacaatcaaaattccacagaaaaactcc
taa

DBGET integrated database retrieval system