KEGG   Cyanistes caeruleus (blue tit): 111937099Help
Entry
111937099         CDS       T05602                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae00590  Arachidonic acid metabolism
ccae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111937099 (PTGS1)
Enzymes [BR:ccae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     111937099 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 111937099
NCBI-ProteinID: XP_023794128
LinkDB All DBs
Position
17
AA seq 584 aa AA seqDB search
MWWLDGDDSLSLSAPAVNPCCYFPCQNQGVCVRVGLRGYECDCTRTGYYGVNCTSPEFWT
RLHNLLKPSPAFYHFILTHFKWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGY
ISWEAYANVSYYTRILPPVPDDCPTPMGTKGKQQLPDPQLLAERFLLRQKFEADPRGTNM
MFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQV
VDGEVYPPMVTEAPVHMVYPSGVPKEQQLAVGQEVFGLLPGLCVYATLWLREHNRVCDLL
KRDHPTWSDEQLFQTARLVLIGETIKIVVEDYVQHLSGYYLSLKFDPELLFGSQFQYRNR
IAVEFNQLYHWHGLMPDSFIIQGQEYSYKQFLYNTSMLMDYGVEALVESFSKQVAGRIGG
GHTINANVLHVAVGVIKESRQLRLQPFNEYRKRFGLKPYKSFQELTGEEEKAAELEELYG
DIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLFGNPICSPEYWKPSTFGGATGF
EIVKTASLKKLVCLNVKKCPFVAFHVPDAAEHGSPRAGGSSTEL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggctggatggtgatgactctctctctctctctgcccctgcagtgaatccctgt
tgctatttcccctgccagaaccaaggggtgtgtgtgagggtgggcctgagaggatacgag
tgcgactgcacacggacgggctactacggggtcaactgcacctcccctgagttctggaca
cgtctccacaacctcctgaagcccagtcctgccttctaccacttcatcctgacccacttc
aagtggttttgggacattatcaacagcaccttcatcagggacacgctcatgaggctcgtg
ctgacagttcgtgccaatctcatccccagcccccccactttcaactctgactatggctac
atcagctgggaggcctatgccaacgtcagctattacacccgcatcctcccgcccgtgcca
gacgactgccccacgcccatggggaccaaagggaagcagcagctccccgacccccagctc
ctggcggagaggttcctgctgcggcagaagtttgaagctgatccccgaggcaccaacatg
atgtttgccttcttcgcccagcatttcacccaccagttcttcaagacatctgggaagatg
ggacgcggcttcaccaaggcgctggggcacggggtggacctgggacatttgtacggggac
aacctgcagcggcagcaccagctgcgactcttccgagatgggaagctgaaattccaggtg
gtggatggagaggtgtacccgcccatggtcaccgaggctccggttcacatggtgtacccg
tcgggagtgcccaaggagcagcagctggcggtggggcaggaggtgttcgggctgctgccg
gggctctgcgtgtacgccacgctctggctacgcgagcacaaccgcgtctgcgacctgctc
aagcgggaccatcccacctggagcgacgagcagctcttccagacggcgcggctcgtcctc
atcggggagaccattaagatcgttgttgaagactacgtccagcacctcagtgggtactac
ctgagcctcaagttcgaccccgagctgttgtttgggtcacagttccagtaccggaatcgc
atcgcggtggagttcaaccagctctatcactggcacgggctgatgcccgactccttcatc
atccagggacaggagtacagctacaagcagttcctctacaacacctccatgctcatggac
tacggtgtggaggcgctggtggagtccttttccaagcaggtggcaggaaggattggtggg
ggacacaccatcaatgccaatgtcttgcacgtggctgttggggttatcaaggagtcccgg
cagctgaggctgcagcctttcaatgagtatcggaaaaggtttggcctgaagccctacaag
tccttccaggagctgacaggagaggaagaaaaggcagcagaactggaagagctgtatgga
gacattgatgctctggagttttacccaggcttgctgcttgagaaaccccaacccaacggc
atttttggggaaagcatggtggaaatcggagctccattttccctaaagggcctttttgga
aatcccatctgctccccagagtactggaaacccagcacatttggcggagcaaccggcttt
gagattgttaagacggcatccctcaagaagctcgtgtgcctcaatgtgaagaagtgcccg
tttgtggcgttccacgtgccggatgctgcggaacacggcagccctcgggctggtggatca
tctacagagctctag

DBGET integrated database retrieval system