KEGG   Cyanistes caeruleus (blue tit): 111945421
Entry
111945421         CDS       T05602                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
ccae  Cyanistes caeruleus (blue tit)
Pathway
ccae04080  Neuroactive ligand-receptor interaction
ccae04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccae00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111945421 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111945421 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ccae04030]
    111945421 (LPAR2)
G protein-coupled receptors [BR:ccae04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111945421 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Rax2
Other DBs
NCBI-GeneID: 111945421
NCBI-ProteinID: XP_023803847
LinkDB
Position
Unknown
AA seq 337 aa
MKHCFYNETLGFFYNNSRKELSPHWRPKDVLVVALGLAVSAVVLLTNLLVIAAVATNRRF
HYPIYYLLANLAAADLFAGVAYMFLMFHTGPRTAQLSLKTWFIRQSLLDTSLTASVVNLL
AIAVERHRTVLTMQLHSEMSAQRVVGLIFSIWAAALLLGLIPSYGWHCLCSLESCSRMAP
LYSRSYLTFWAVSNLAVFLVMVVVYGHIFVYVRRRMARMARHTGAHPRHRDTVMALVKTV
TIVLGAFVVCWTPGQVLLLLDGLGCQSCDVLAVEKYVLLLAEINSLINAIVYSWRDNEMR
STFRRILGFPCQRRAKYAAPEPGLGSHYGNFTVDSSI
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaagcactgcttctacaacgagaccctcggcttcttctacaacaacagccgcaaggag
ctcagcccccactggcgccccaaggacgtcctggtggtggccctgggcctggcggtcagc
gccgtggtcctgctcaccaacctgctggtcatcgccgccgtggccaccaaccgccgcttc
cactaccccatctactacctcctggccaacctggccgccgccgacctcttcgccggcgtg
gcctacatgttcctcatgttccacaccgggcctagaaccgcccagttgtccctcaagact
tggttcatccggcagagcctgctggacaccagcttgaccgcttcggtggtcaacctgctg
gccatcgcggtggagaggcaccggacggtgctgaccatgcagctccacagcgagatgtcg
gcgcagcgcgtggtgggtttgatcttctccatctgggcggcggcgttgttgctggggttg
atcccgtcctacggttggcactgcctgtgttccttggagagctgttccaggatggcgccg
ctctacagccggagctacctgaccttctgggccgtgtccaacctggccgtgttcctggtg
atggtcgtggtctacgggcacatcttcgtctacgtccgcaggaggatggcgcgcatggcg
cggcacacgggcgcgcacccgcggcaccgcgacaccgtcatggcgctggtcaagaccgtc
accatcgtgctgggcgctttcgtggtttgctggaccccgggccaggtcctgctcctcctg
gacgggctgggctgccagagctgtgacgtgctggccgtggagaaatacgtgctgctgctg
gccgaaattaactcgctaattaacgccatcgtttactcctggcgggataacgagatgagg
agcaccttccgccgcatcctcggcttcccgtgccagcgccgcgccaaatacgccgcgccc
gagccggggctcggctcccactacggaaacttcaccgtggattcttccatttag

DBGET integrated database retrieval system