KEGG   Cajanus cajan (pigeon pea): 109799007Help
Entry
109799007         CDS       T04868                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj03030  DNA replication
ccaj03410  Base excision repair
ccaj03420  Nucleotide excision repair
ccaj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109799007
   03410 Base excision repair
    109799007
   03420 Nucleotide excision repair
    109799007
   03430 Mismatch repair
    109799007
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ccaj03032]
    109799007
   03400 DNA repair and recombination proteins [BR:ccaj03400]
    109799007
Enzymes [BR:ccaj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109799007
    6.5.1.6  DNA ligase (ATP or NAD+)
     109799007
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109799007
DNA replication proteins [BR:ccaj03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109799007
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109799007
DNA repair and recombination proteins [BR:ccaj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109799007
   NER (nucleotide excision repair)
    Other NER factors
     109799007
   MMR (mismatch excision repair)
    Other MMR factors
     109799007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 109799007
NCBI-ProteinID: XP_020215067
LinkDB All DBs
Position
4
AA seq 768 aa AA seqDB search
MLALRFSPPLYTSITLRVSSLFSLSSAPFRAMSKRPSAFDALMSGARAAAKKSQSQPAQP
SSSPRKRKSPHSTSSQNPSITNPLEKPPKPEPASSEPAPAPKKKLLSLSLPSPSSSEDNT
AELKKRASLLKKKPSDFDPASVAWWQNGEPVPFLFLALAFDMISLESGRIVMTDIVCNVL
RTVMHVTPEDLVPVIYLSANKIAPAHTGLELGVGEASIIRALASAYGTNEASVKTQYEKK
GDLGLVAKASRSSQSMFRKPVALTIRKVLNTFRVIAKESGKDSVEKKKDLIRALLVAATD
CEPQYLIRLLQAKLRIGYSEKTLLAALGQAAAYNTEEHSKPPPEIKSPLEEASNIIKQVY
SVLPDYDKIVSALLTEGLWMLPKTCKFTPGVPIEPMLSKATKGVSEVLNKFQDVEFTCEY
KYDGERAQIHYVENGSVEVYSRHQERNTDKYPDVVAAVSRLKKPTVSSFVLDCEIVAYDR
AKQQIESFQKLSTRPRKKVDIKDVKVDVCVFAFDLLYLNGQELLQENLRVRREHLYASFE
EETGFLQFATSITSNDVEEIQKFLDKAVNASCEGLIVKTLNEDATYEPAKRSLNWLKLKK
DYLENIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDQENEEFQTICKIGTGFSEDKLEE
CSSSLRSKVIPKPKTYYRYAEKINPDVWFEATEVWEVKAADLTISPVYRAAVGIVDSDKG
ISLRFPRLLRVRPDKAPEQATSSEQVAEMYNAQKHNQTNKLDDSENDD
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcattgcgtttctctcctcctctctacacctccataactcttagggtttcctct
ctcttctctctctcctccgcccctttccgcgccatgtccaagcgcccctccgccttcgac
gctctcatgtccggcgctcgcgccgccgccaagaagtctcaatcccagccggcgcaaccc
tcctcctctcccaggaaaagaaaatccccgcactccacctcctctcaaaaccctagcatc
accaatcccctcgaaaaacctcccaaacctgaacccgcctcctccgaacccgcgccggca
ccgaagaaaaagttgctcagcctgtccctaccatctccctcttcgtcggaggataacacc
gcggagctcaagaagcgagcttcgctgctgaagaagaaaccctcggatttcgacccggcc
tccgttgcttggtggcagaacggcgaacccgtgccgttcctcttcctcgcattggcattc
gacatgatttccctcgagtccgggagaatcgtcatgacggacatcgtctgcaacgtgctt
aggactgtcatgcacgtcacgccggaggatctcgttcccgtcatttacctctccgccaac
aagatcgctccggcgcacaccggcctcgaattgggcgtcggcgaggcttccatcatcagg
gccctcgccagcgcctacggaacgaacgaggcatctgtcaagactcagtacgagaaaaaa
ggggatttgggcttggttgctaaggcgagccgttcttcgcagagcatgtttaggaagcct
gttgcattgactattaggaaggttttgaatacttttcgcgttattgctaaggaatctgga
aaagacagtgtagagaagaaaaaagatcttatcagggcacttcttgttgctgctactgac
tgtgaacctcaatatctaatccgactgctacaggcaaagttgcgaattggctattctgag
aaaactctcttagctgcattaggccaagctgcagcatacaacactgaagaacattctaaa
ccccctcctgaaattaagtctcctttagaagaggcttcaaatattattaaacaagtctat
tctgttcttcctgactatgacaaaatagtatctgcactgcttacagagggtctatggatg
cttccaaagacatgtaaatttactccaggtgttccaattgaacctatgctgtccaaggca
acaaagggtgtatcagaagttctaaataaattccaggatgtggagtttacctgtgaatac
aaatatgatggagagcgtgcccagatacattatgtggagaatggctcagttgaggtttac
agtagacaccaagaacggaacactgacaagtatcctgacgttgttgctgcagtttcaagg
ttaaagaaaccaactgtatcgtcatttgttcttgattgtgaaattgttgcatatgatcgt
gcaaaacagcaaatcgaatctttccagaagcttagtactcggcctcgcaagaaagtagat
atcaaggatgtaaaggttgatgtttgcgtatttgcttttgatctgttgtatctgaatggc
caagaacttctgcaggaaaatcttagagtccgtagagagcatctctatgcctcttttgag
gaagaaactggatttcttcagtttgcaacatcaataacatcaaatgatgttgaggaaata
cagaaatttcttgacaaagctgttaatgcaagttgtgagggattaattgttaaaacatta
aatgaagatgctacatatgaacctgccaagcgttctctcaactggctaaaattgaagaaa
gattatctggaaaatataggggactcattagatttggtgcctattgctgctttccatggt
cgtgggaaacgtacaggagtttatggtgccttcctccttgcatgctatgaccaagaaaat
gaagaatttcaaactatctgtaagataggaacgggattctctgaagataagcttgaagaa
tgttcttctagtcttcgttctaaagtgattcccaaaccaaagacatactatcgatatgca
gaaaaaatcaatcctgatgtctggtttgaagccactgaggtgtgggaggtgaaagctgca
gacctgaccattagccctgtttaccgtgctgcagtgggcatagtagattcggacaagggc
atatctcttcgatttccacgactactccgagtccggcctgacaaagctcctgaacaggct
acgtcatctgagcaggttgctgaaatgtataatgctcaaaaacacaatcaaacgaacaag
ctagatgacagtgaaaatgatgattga

DBGET integrated database retrieval system