KEGG   Cajanus cajan (pigeon pea): 109803354Help
Entry
109803354         CDS       T04868                                 

Definition
(RefSeq) malonyl-CoA decarboxylase, mitochondrial isoform X1
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ccaj  Cajanus cajan (pigeon pea)
Pathway
ccaj00410  beta-Alanine metabolism
ccaj00640  Propanoate metabolism
ccaj01100  Metabolic pathways
ccaj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    109803354
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109803354
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109803354
Enzymes [BR:ccaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     109803354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-GeneID: 109803354
NCBI-ProteinID: XP_020220477
LinkDB All DBs
Position
8
AA seq 535 aa AA seqDB search
MNKKALSILMRARMKPNLSLSPLSLTNATSQLQQQNSRQNESPGEGNSPPNDSANSEREF
KRVRASMHSAISMNKTEVLDDVLNSFSEGYFSLSRVNRRNLLLVLAREYDLNRSQVRELI
NQYLGLELPADKAQVSGFEDEALFSPFHRIERNLRHALQPVYEILFERLNTHPGGLRILT
IVRADILSILAEENIASLRALDSNLKEKLITWLSPAALELHQITWDDPASLLEKIVAYEA
VHPISNLLDLKRRLGIGRRCFGYLHPAIPGEPLIFIEVALLKDVAQTIQEVLWDSPPISE
NEATCALFYSISSTQPGLAGINLGKFLIKRVVTQVKREMPHISTFATLSPIPGFMSWLLS
KLASQTVLAEGDNLSQPQAEGSGSTFYENILKPGEEEALMSLPKRRDIATGKNGMDVMFN
LLTSSSYKWIHSPELLSALKPPLMRLCARYLLQEKKRGKALDSVANFHLQNGAMVERINW
MADRSEKGLSQSGGIMVNYVYRLDHIEEYAHSYFSNGEIHASSDLHRCIDVVDTA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaagctttgtccattttgatgcgcgccagaatgaagcccaacctttctctc
tctcctctctctctaactaacgcgacgagtcaattgcagcagcagaattcccgccaaaat
gaatctccaggtgaaggaaattcaccgcctaatgactccgccaactccgagagagagttt
aagcgtgtgcgtgcctcaatgcactctgctatatctatgaacaaaacagaagttctggat
gacgtgcttaatagtttctcggagggttattttagcctttctcgtgtaaaccgtcgcaac
ttgctccttgttcttgctagagagtatgatctcaatagatcacaagttcgtgaactgata
aatcagtaccttggacttgaacttcctgctgacaaagctcaagtgagtggcttcgaagat
gaagccttgttttctccttttcatcggattgagaggaatttgaggcatgcccttcagcca
gtttatgaaattctctttgagcgtctcaacactcatcctggagggttgaggatcttaacc
attgttcgagcagatatcctatctattcttgcagaggagaatattgcatctctgagagca
ttggattctaatttaaaggaaaaacttattacgtggcttagtcctgctgccttagagctt
caccagattacatgggatgatcctgcttctttgctggagaaaattgttgcttatgaagct
gtgcacccaattagcaaccttctagatcttaagagaaggctgggaattggccgtcgttgt
tttggatatttacatccagcaattcctggtgaacccctaattttcattgaagttgcacta
ctgaaggatgttgctcaaactatacaggaagttttgtgggatagtcctcctatatctgaa
aatgaggcaacatgcgccttgttctactctatatcatcaactcagcctggcttagcaggg
atcaacttaggaaaatttcttatcaaacgagttgtaacacaggtgaaaagagagatgcca
catatttccacctttgcaactctgagtcccatcccgggattcatgtcgtggctgttatcc
aagctagcatctcaaacagtgcttgctgaaggagacaatttgtcacaaccacaagctgaa
ggatccggctccactttctatgagaatatacttaaacctggggaagaagaagcacttatg
agtttacctaaacgcagagatattgccacgggaaaaaatggaatggatgtgatgttcaac
ttgcttacttcttcatcctacaagtggatccattcgccagaacttctgtcagcattaaaa
ccccctttgatgcgattatgtgccaggtaccttctgcaagagaagaaaagaggaaaagct
ttggattctgtagcaaattttcacttgcaaaatggagcgatggtcgaaagaattaactgg
atggcagatcgatcagaaaaaggtctttctcaaagtggagggatcatggtgaactatgtg
tataggctggatcacatagaggaatatgcccattcatacttcagcaatggagaaattcat
gcatcaagtgatctccatcgctgtattgatgtagtggatactgcttag

DBGET integrated database retrieval system