Ceratina calcarata (carpenter bee): 108628850 Help Entry 108628850         CDS       T06061                                  Name (RefSeq) glutathione S-transferase-like   KO K04097   prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] Organism ccal  Ceratina calcarata (carpenter bee) Pathway ccal00480   Glutathione metabolism ccal00590   Arachidonic acid metabolism ccal00980   Metabolism of xenobiotics by cytochrome P450 ccal00982   Drug metabolism - cytochrome P450 ccal01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:ccal00001]  09100 Metabolism   09103 Lipid metabolism    00590 Arachidonic acid metabolism     108628850   09106 Metabolism of other amino acids    00480 Glutathione metabolism     108628850   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     108628850    00982 Drug metabolism - cytochrome P450     108628850 Enzymes [BR:ccal01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      108628850  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.99  Other intramolecular oxidoreductases     5.3.99.2  prostaglandin-D synthase      108628850 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_N GST_N_2 GST_N_3 GST_N_4 Motif Other DBs NCBI-GeneID:  108628850 NCBI-ProteinID:  XP_026672588 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MSSYKLIYFNFTGLGEPIRYLLHQSGIEFENKILNVEEWPKIKSTMPLGQVPVLEIDGKP YVQSKAIGRLIAKRNNLYGANDVEEYEIDATIDFVADLSV NT seq 301 nt NT seq  +upstreamnt  +downstreamnt atgtccagttacaagcttatttattttaattttactggactgggtgagccaatcaggtac cttttgcaccaaagcggtatcgaatttgagaacaaaattctcaacgtcgaagaatggccc aaaattaaatccacgatgccattgggtcaagtaccagttttggagatcgatggaaagccg tacgttcaatcgaaagctatcggtcgacttatcgcaaagaggaacaatctttacggtgca aatgacgtcgaagagtacgaaatcgacgccaccatcgatttcgttgcagatttatcagtt t

DBGET integrated database retrieval system