Castor canadensis (American beaver): 109686941 Help Entry 109686941         CDS       T04791                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism ccan  Castor canadensis (American beaver) Pathway ccan04514   Cell adhesion molecules ccan04530   Tight junction ccan04670   Leukocyte transendothelial migration ccan05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     109686941  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     109686941  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     109686941  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     109686941  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccan03037]     109686941    04147 Exosome [BR:ccan04147]     109686941 Cilium and associated proteins [BR:ccan03037]  Other cilia and associated proteins   Stereociliary proteins    109686941 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    109686941   Exosomal proteins of colorectal cancer cells    109686941 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin TMEM37 Claudin_2 Motif Other DBs NCBI-GeneID:  109686941 NCBI-ProteinID:  XP_020020106 UniProt:  A0A8B7UKG1 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MASMRPQVTGIALAVLGRLGAILSCALPMWRVTSLMNSDIHEAEFVSEGLWKVCNILNTT QIQCAKHKSLLYVPDDLLVARLLVVTCIIVTALGLLFSVVGDKCSKWVDDETINAKIMTK AGLMLLMSGLW NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcttccatgaggccacaggtgacaggcattgccctggccgtgctgggtcggctgggt gccattctgagctgtgcactgcccatgtggagggtgacatccttgatgaacagtgacatc catgaagctgagtttgtgtcggagggcttgtggaaggtctgcaatattctgaacacaacc cagattcaatgcgcaaaacacaagtcactgctatatgtgccagacgaccttttggtggct cgccttctcgtggtcacctgcatcattgtgactgcgctgggtttgctgttctccgtggtg ggggacaagtgcagcaagtgggtggacgatgagaccatcaatgccaagatcatgaccaag gctggtctgatgctcctgatgtcaggtttatggtga

DBGET integrated database retrieval system