KEGG   Castor canadensis (American beaver): 109692474Help
Entry
109692474         CDS       T04791                                 

Gene name
Ptgs1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00590  Arachidonic acid metabolism
ccan01100  Metabolic pathways
ccan04611  Platelet activation
ccan04726  Serotonergic synapse
ccan04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109692474 (Ptgs1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109692474 (Ptgs1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    109692474 (Ptgs1)
  09156 Nervous system
   04726 Serotonergic synapse
    109692474 (Ptgs1)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109692474 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 109692474
NCBI-ProteinID: XP_020028681
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MTPGRSLSFRFPLLLLLLPPFPVLPADSGASAPVNPCCYYPCQNQGVCVRFGLDHYQCDC
TRTGYSGPNCTIPELWTWLRHSLRPTPTFIHSLLTHGRWFWEFVNATFIRDMLMRLVLTV
RSNLIPSPPTYNLAHDYVSWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLGR
RFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLE
RQYHLRLFKDGKLKYQVLNGEVYPPSVEEAPVLMHYPKGIPPQNQMAVGQEVFGLLPGLM
LYATIWLREHNRVCDLLKTEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQL
KFDPELLFRAQFQYHNRIAMEFNHLYHWHPLMPDSFKVGSQEYNYEQFLFNTSMLVDYGV
EALVDAFSHQNAGRIGGGRNMDHHVLHVAVDVIKESREMRLQPFNEYRKRFGMKPYTSFQ
ELTGEKEMAAELEELYGDIDALEFYPGLLLEKCLPNSIFGESMIEIGAPFSLKGLLGNPI
CSPEYWKPSTFGGEMGFNIVNTATLKKLVCLNTKTCPYVSFRVPNFSPDDGPAVERPSTE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagggaggagtctctcgttccggttcccgctgctcctgctcctgctgccacct
ttcccggtcctgcccgcagactctggggcgtccgcaccggtgaacccctgctgttactat
ccatgccagaaccagggtgtctgtgttcgcttcggccttgaccactaccagtgtgactgt
acccgaacgggctactctggccccaactgtactatccctgagctctggacctggctccgg
cattccttgcggcccacccccactttcatccactccctgctcacacatgggcgctggttc
tgggagtttgtcaatgccaccttcatccgagacatgcttatgcggctggtactcacagtg
cggtctaatcttatccccagtcctcccacctacaacttagcacatgactatgtcagctgg
gagtccttctccaatgtgagctactacactcgaattttgccctctgtgcccaaagactgc
cccacgcctatggggaccaaagggaagaaacaactgccagatgcccagcttctgggtcgt
cgcttcctgctcaggagaaagttcattcctgacccccaaggcaccaacctcatgtttgcc
ttctttgcacaacacttcacccatcagttcttcaaaacttctggcaaaatgggccctggc
ttcaccaaggccttgggccatggggtagatcttggtcacatttatggagacaatctggaa
cgtcagtaccacctgcgcctctttaaggatgggaaactcaaataccaggtgctgaacgga
gaggtgtacccgccatcagtggaagaggcgccagtgttgatgcactatccaaagggcatc
ccgccccaaaaccagatggccgtgggccaggaggtgtttgggttgcttcctgggcttatg
ctctacgctaccatctggctgcgggagcacaaccgcgtgtgcgaccttctgaagacggag
cacccaacctgggatgatgaacagctcttccagactacccgcctcatccttataggggag
accatcaagattgttattgaggagtatgtgcaacagttgagtggctacttcctgcagctc
aagtttgacccagaactgctattcagagcccagttccaataccacaaccgcattgctatg
gagttcaaccacctctaccactggcacccgctcatgcctgactccttcaaggtgggctct
caagagtacaactatgagcagttcttgttcaacacctccatgctggtggattatggagta
gaggcgctggtggatgccttctctcaccagaatgctggccggattggtgggggtaggaat
atggaccaccacgttctgcacgtggctgtggatgtcatcaaggagtctcgagagatgcgg
ctacagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacatctttccag
gagctcacaggagagaaggagatggcagctgagttggaggagttatatggagacattgat
gccttggagttctacccaggactgcttctcgaaaagtgcctgcccaactccatcttcggg
gagagtatgatagagattggagctcccttttccctcaagggtctcctagggaatcctatc
tgttctcccgagtactggaaaccaagcacatttggtggtgagatgggcttcaacattgtt
aacacagccacgctgaagaagctcgtttgtctcaacacgaagacctgtccctatgtttcc
ttccgtgtgccaaacttcagtccggatgatgggcctgctgtagagcgaccatccacggaa
ctctga

DBGET integrated database retrieval system