KEGG   Castor canadensis (American beaver): 109700284
Entry
109700284         CDS       T04791                                 

Gene name
Nlrp4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109700284 (Nlrp4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ccan04054]
    109700284 (Nlrp4)
Membrane trafficking [BR:ccan04131]
 Autophagy
  Other autophagy associated proteins
   Others
    109700284 (Nlrp4)
Pattern recognition receptors [BR:ccan04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   109700284 (Nlrp4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_25 AAA AAA_22 AAA_16 ResIII AAA_30 DUF2075 AAA_19 AAA_11 Mg_chelatase
Other DBs
NCBI-GeneID: 109700284
NCBI-ProteinID: XP_020040999
LinkDB
Position
Unknown
AA seq 986 aa
MASSFFSEFGLTWYLEELNKKEFMKFKGLLKEEILQLDLKQIPWCEVKRASREDLANLLI
KYYEKQQAWAVTFSIFQKINRKDLCDRAKRESTGHTKRYQAHIQKKISNMWSREPITAIH
DFFDQKITPKEREYFEPLIAPKTTRKQSHTVLLKGIPGTGKTMVLMKLILAWAEGSLCQD
RFSYVFYFCCRELRTLTETSLAELISRDWPDSGVAIAEIMSQPEQLLFIIDSFDELKCSL
DGPEAELCSDWMEKQPIKVLLGSLLRKKMLPESSLIIATTPSYSPGLEERLESPDIRTAI
GFEDSNKEEYFHCVIKDSSRAMQAFRLVREYEQLSSMCQLPVLCWIVCTCLKQELERGRD
LALICQRTTSLYASFIFNLFTPKGANCPNWQSQGQLLGLCSLAAEGMWTDTFVLRKEALS
RNGIADSDIPTLLDIKILLRDKNCENSYVFIHPSVQEFCAAMFYLLKSHSEHPNSAVACS
ETLLFTFLKKVKDHWVSFPRFLFGLLHEKEQQKLNAFFGFQLLSQEVKQRFHQCMKSIGE
SEDLREQVDFLGLFYCLFEMQNEAFVKQTMDFLQEVNLSITKKSDLIVCAYCLKKSSGLR
KLLFSIQNVFKEENGHCSMSDFSLTCWHEICSVLTTNQHLQELQVKDGVLSESACETLYE
QLRQPNCVLQSLEINRVVFYCECSHLFEVLIHNSNLKHFKFTHISLSRSDVKLLGDTLKH
PECNIERLQLVDCGLVSDDCDVFASVLVSSKKLKHLDIACNYLEEGLRSLCRALCHPDCT
LSLLVLANCHLSEHCWEYLSEVVLSNKFLRHLDLSANVLTNAGLKTLCEALRHPECSLNS
LCLIKCSIAASGCQALASVLSSNQNLKILQIGGNNIEDVGVKLLCGALVHPNCHLEVLGL
EACKLTSVCCEDLSLVLTHSKTLWGLNLSRNALDYNGVVVLCEALRHPECSLHLLGVSKA
DLDEETQALLTAEEEKNSSLTIIGSQ
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggcatcatctttcttttctgaatttggccttacatggtatctggaggagctcaacaag
aaggagttcatgaaatttaaaggactcctcaaggaagagattttgcaacttgaccttaag
caaattccctggtgtgaagtgaagagagcatcccgggaagacctcgccaacttactgatc
aaatattatgagaaacaacaagcatgggctgtgacgttcagcatctttcagaagatcaat
agaaaagatctctgtgacagggccaagagagagagtactggacacaccaagaggtatcaa
gctcacatacagaagaaaatcagcaatatgtggtccagagaacccatcactgcaattcat
gatttctttgaccagaaaatcaccccaaaagaacgtgaatattttgagccccttattgct
cctaagacaaccaggaagcagtctcacacagtgctgcttaagggaatcccaggaactggg
aaaacgatggttctgatgaagttaatattggcctgggcagaaggcagcctctgtcaggat
agattctcatatgttttctatttctgctgccgagaattaagaacactgacagaaacaagc
ctggctgaactcatctccagagactggcctgactctggcgttgccatagcagagatcatg
tcccaaccagagcagctcttgttcatcattgatagcttcgacgagctgaaatgcagcttg
gatggaccggaggcagagctgtgcagtgactggatggagaagcagccaataaaggtgctt
ctgggcagtttgttgaggaagaagatgctcccagagtcgtccttaatcattgcaactacc
cctagctactcaccaggactggaggaaaggttggagagcccagacattagaacagccata
ggattcgaagatagcaacaaggaggagtacttccactgcgtgattaaagacagtagtaga
gccatgcaagccttcagattggtgagagaatatgaacagctgtcttccatgtgccaactc
cctgtgctttgttggatcgtgtgcacttgtctgaagcaggagttagaaaggggaagagac
ctggcgctgatctgccaacgcaccacctctctgtatgcctccttcatctttaacttgttc
actcccaagggtgctaattgtccaaattggcaaagccaaggccagctgctaggcctgtgt
tccctggccgcagagggcatgtggactgacacatttgtgttgagaaaggaggctctcagt
agaaatgggatagctgactctgacatccccacattgctggacatcaagattcttctgagg
gataagaattgtgagaactcctatgtgttcatccacccatctgtccaggagttctgtgct
gccatgttttatttgctaaagagccacagtgagcaccccaactcagctgttgcatgctca
gagacactcctgtttacatttttaaagaaagttaaagatcattgggtttctttcccacgt
ttcttatttggccttttacatgaaaaggaacaacaaaagctgaatgcattttttggcttc
caactattatcccaagaggtaaagcagcgatttcaccagtgcatgaagagcataggtgag
agtgaggatcttcgggaacaggtagacttcttgggattattttactgcctgtttgagatg
cagaatgaagcctttgtgaagcagacaatggacttcctccaagaagtgaatctttctatc
actaaaaaatcagacttgatagtttgcgcctattgtttaaaaaaaagttctggcttgagg
aaacttttgttttcaatccaaaatgtctttaaggaagagaatggacactgctccatgtca
gatttcagtctcacctgttggcatgagatatgctctgtgcttacgactaaccagcacctc
caagaactgcaggtgaaagatggggtcctcagtgagtcagcctgtgagaccttgtatgaa
cagctgaggcagcccaactgtgtccttcaaagtcttgagataaatagggttgtcttttat
tgtgagtgttctcatttatttgaggtgctcattcataactcaaatttgaaacacttcaag
ttcacccacatcagcctatcccgttctgacgtgaagttgcttggtgataccttgaagcat
cccgagtgtaacatagaaaggctgcagctggtagactgtggcctggtgtctgatgactgt
gatgtcttcgcctcagtcttggtcagcagcaagaagctgaaacatctggatatagcatgc
aactacctggaggaagggctgcgctcactgtgcagggcattgtgccacccagactgcacc
ctgagcctattggttttggcaaactgccacctcagtgagcattgctgggaatacctctct
gaagttgttctgagtaacaaatttctgaggcatctggacctcagcgcaaatgtcctgaca
aatgcaggcctgaagaccctctgtgaggccctgagacaccccgaatgcagcctgaactca
ctgtgcttgataaaatgttccattgctgctagtggctgtcaagctcttgcctcagttctc
agcagcaaccagaacctgaaaattctacagattggaggcaataacatagaggatgtgggc
gtgaagctgctgtgtggagccttagtgcatcccaactgccacttggaggttcttgggttg
gaagcctgtaagttgaccagtgtctgttgtgaggacctctctttggttctcacccacagt
aagaccctgtgggggctaaacctgagtcggaatgccttggactacaacggggtggttgtg
ctgtgtgaggctctgagacacccagaatgttccctgcacctgcttggggtgagcaaagct
gacttggatgaagaaacacaggctcttctgacagctgaggaagagaaaaattcttccttg
accatcataggtagccaataa

DBGET integrated database retrieval system