KEGG   Cyprinus carpio (common carp): 109103132Help
Entry
109103132         CDS       T05134                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00512  Mucin type O-glycan biosynthesis
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109103132 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccar01003]
    109103132 (wbscr17)
Enzymes [BR:ccar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109103132 (wbscr17)
Glycosyltransferases [BR:ccar01003]
 O-Glycan biosynthesis
  Mucin-type
   109103132 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 109103132
NCBI-ProteinID: XP_018972016
LinkDB All DBs
Position
29
AA seq 615 aa AA seqDB search
MVRFAGFRTPKYFHGLVMRRWKILLVLNVFTMAGFITFWGKCNLRTTKAVGQQAVAADVR
GQTHLNGSAQETSITHDVLLKRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGRGGLPATLT
PEEEKEAKYLREKYGYNAFLSDKISLDRSIPDYRPSKCKKAFYSRDLPQISIIFIFVNEA
LSVILRSVHSAVNHTPAHLLKEIILVDDNSDDVQLKGPLEEYVNKRYPGLIKIVRNQKRE
GLIRARIEGWKVATGEVTGFFDAHVEFTPAWAEPVLSRIKEDHKRIILPSIDNIKDESFE
LERYENSGHGYNWELWCMYISPPKQWWDEGDTSAPIRTPAMIGCSFVVNREYFGELGLLD
AGMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEV
WMDQYKSNVYLAWNLPMKNHGIDYGDISQRLALRKRLQCKNFEWYLDNIYPEMRRYNNTL
FYGEIRNTNVTHLCVDQGIKENHTATLHPCHGWGPQLGRYTKEGYLFLGPLGSTGEDTRC
VVDDKISSYPQLLNCEKVSSVSQKTWHFAQNEAIINRATGRCLEIVQANVYFGYALILRS
CTGQKWSIKNLMKQD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgattcgctggattccgaacaccaaaatactttcatggccttgtgatgagaaga
tggaaaatcttactggtgctgaatgtgtttacgatggccggcttcatcactttttggggc
aagtgcaatttacgcacaaccaaagctgttggtcaacaggcggtggctgctgatgtgaga
ggacagacgcatctgaatggatctgctcaggagaccagcatcactcatgatgtgctctta
aagagactgggatcactggaagatgtggtgtacagacaactcaatggtttgtccaagtct
cttggactcattgaaggttttggtggccggggtagaggaggtctaccagcaacacttacg
ccagaggaagaaaaggaggccaaatacctgagggagaaatatggctacaatgcatttctg
agtgacaaaatctctctggatagatctattccagattatcgacccagcaaatgcaaaaag
gccttttattcccgtgacctgccacagatctccatcattttcatctttgtaaatgaggcg
ttgtctgtcatcctgcgttcagtccattcagctgtcaaccacacaccagctcatctccta
aaggaaatcatcttggtggatgacaacagtgatgacgtacaactgaaagggccactggag
gagtatgtcaacaagcgctacccgggtcttatcaaaatagtgcgcaatcagaagagagaa
ggcctcatccgggctcgcatcgagggctggaaagtggccactggggaggtgactggcttc
tttgatgcccatgttgagttcacgcctgcatgggctgaaccagttctgtctagaatcaag
gaagaccacaagaggatcatactgccctccatagataacattaaagacgagtcgtttgag
ctggaacgctatgagaactcaggccatggttataactgggagctctggtgtatgtatatc
agccctccgaaacagtggtgggatgaaggagacacttctgcacctatcaggacgcctgca
atgataggctgctcttttgtggtaaaccgggaatactttggggagttgggcctactggac
gcagggatggacgtgtatggaggcgaaaatatagagctgggaatcagggtttggctgtgt
gggggaagcatggaagttctgccttgttctagagtggcccatattgcaagaacaaaaaag
ccctaccacagtaacatcgcctttcacactagacgcaatgcactgagggtggcagaagta
tggatggaccaatacaaatcaaatgtctatttggcatggaacctcccaatgaagaaccat
ggcattgactatggagacatatcccagagattagcgctcaggaaaagactccagtgcaaa
aactttgagtggtacctcgacaatatctatccagagatgaggagatacaacaacactctc
ttttatggagagatacgcaataccaatgtgacccatctgtgtgtggaccagggcataaag
gaaaaccacacagcaactctgcacccctgccatggctggggccctcagttgggtcgctac
actaaggagggttatctttttctgggtcctctgggaagcactggcgaagatacgcggtgt
gtggtggacgataaaatcagcagctacccacagctcctgaattgtgagaaagtctctagc
gtaagccagaaaacgtggcactttgcacagaatgaagcaatcatcaaccgagctacagga
cgctgtcttgagatagtgcaggctaatgtctacttcggctacgctctgatcctgcgttcc
tgcactggtcagaagtggagcatcaagaatttgatgaaacaggactga

DBGET integrated database retrieval system