KEGG   Cyprinus carpio (common carp): 109103596
Entry
109103596         CDS       T05134                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00220  Arginine biosynthesis
ccar00330  Arginine and proline metabolism
ccar01100  Metabolic pathways
ccar04020  Calcium signaling pathway
ccar04146  Peroxisome
ccar04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109103596
   00330 Arginine and proline metabolism
    109103596
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109103596
   04020 Calcium signaling pathway
    109103596
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109103596
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109103596
SSDB
Motif
Pfam: NO_synthase Flavodoxin_1 FAD_binding_1 NAD_binding_1
Other DBs
NCBI-GeneID: 109103596
NCBI-ProteinID: XP_018972521
LinkDB
Position
29
AA seq 876 aa
MLKWESYTESCKLRKEPKVKMGNQSSKASKNVILHQTKPNTQWENNNVILQQIKPNTQWE
NNNVILQQIKPNTQWENKKVIPQQITPNTQWENKVNQCPFSKQVKNYQDGLCHQDTLHHR
AVKSQICTSKVCEGSIMTPKAMTRCASSTLPSSDDILMQAIDFINQYYKSNKNLKVEEHL
SRLEEVAKEIEATGSYQLTTKELEFGAKQAWRNAPRCIGRIQWANLQLFDARKCRTAEDM
FQMLCDHIQFATNGGNLRSAITVFPQRTEGQHDFRVWNSQLIRYAGYKMTGGTIIGDPAS
VDFTEICIQLGWTPNYGQFDVLPLVLQANGEDPQFFEIPQHLILEVPMEHPQPPELLTEK
NKVTITDHHTASESFMQHMEMEVRLRGGCPADWVWLVPPMSGSLTPVFHQEMLNYILSPF
FYYQPDPWLTHKWKDKKRKERRHTISFKGLIRAVLFSQTLIKSALAKRVRCTVLYATETG
KSQTFAKKLNTMMNCAFSSRVVCMEDYNFSELEMESLLIVVTSTFGNGDCPGNGECFKKQ
LLSLKNLRNKVRYCVFGLGSRMYPHFCAFAHAVDDRFAALGAIRVSSTGEGDELNGQEEA
FSAWACTAFKDACKEFNIQGQLPGKEGLADSWDPQRHRVQNDSCTLDRITALSALHSKAV
VPMKLKRRQNLQNPKSSRATILVELEMDGSTETLNFVPGDHVGIFPGNSPELVAGILKHL
PNAPPINQSLRLEFLSAYPDGERWQRDERIPPCPLAQALTYYLDVTTPPSQSLLRKLSKI
AKQEDHRQRHRQRLLALASVYVQDILREQLNDKVFEVLHHNPGHLYICGGMNMAHDVAAT
IKEILVSRLGITLTQAEEYLSRLKNEKRYHEDIFGS
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgttaaagtgggaaagctacacagaaagttgcaaactgagaaaagaacccaaggtaaaa
atgggtaaccagtcctctaaagccagcaagaatgtaatactgcaccagactaaaccgaat
acgcaatgggagaacaataatgtaatactgcagcagattaagccgaatacgcaatgggag
aacaataatgtaatactgcagcagattaagccgaatacgcaatgggagaacaagaaggta
ataccacagcagattacaccaaatacgcaatgggagaacaaggtgaatcaatgcccattt
tccaagcaagtgaagaactaccaggatggcttgtgccatcaggacacattacatcataga
gcggttaagagccagatttgtacgtctaaagtctgtgaaggctctattatgactccaaag
gctatgacgcgctgtgcctcctccaccctgccaagctcggatgacatcctcatgcaagct
attgacttcatcaatcagtactacaagtcaaataaaaacttaaaagtcgaggagcatctg
tctcgtttggaggaagtcgcgaaggaaatagaggccactggctcatatcagctcaccaca
aaagaactggaatttggggccaagcaagcatggagaaatgcacccagatgtattggaaga
attcagtgggctaatttgcagctgtttgatgcacgtaaatgcagaactgctgaggatatg
tttcagatgttgtgcgatcatattcagtttgctaccaatggaggcaatctcaggtctgcc
atcactgtttttcctcaaagaactgaaggccaacatgatttccgtgtatggaatagtcaa
ctcatacgatacgctggctataagatgacaggtggtacaataataggagatcctgccagt
gttgacttcacagagatttgtatccagcttggatggacaccaaactacggtcagtttgat
gtgcttccactggtgttacaagctaatggagaggaccctcagttttttgaaattccccaa
catttaattttggaagttcccatggagcacccacaaccaccagagctcttgactgagaaa
aataaggtcaccattaccgaccaccatactgcatcagagtccttcatgcagcacatggag
atggaggtgcgtctgcgcggaggctgtccagccgattgggtctggctggtgccaccaatg
tctggatctctaacccctgtgtttcaccaggaaatgctgaattacatcctgtcacccttt
ttctactaccagcctgatccatggctgacacacaagtggaaagacaagaagagaaaagag
aggaggcatacaatcagcttcaaaggattgatcagagcagtgctcttctctcagacactc
attaaatcagccctggccaagagggtgcgttgcactgttctctacgccacagaaacggga
aaatcacagacttttgctaagaaactaaacaccatgatgaattgtgccttcagctcccgg
gtggtttgcatggaggactacaatttcagtgaactcgagatggaaagcctcttaattgtt
gtcaccagcacctttggcaatggagactgtccaggaaatggagagtgtttcaagaagcag
cttctcagcctgaaaaacctcagaaacaaagttaggtactgtgtgtttggtcttggctct
cgaatgtacccacacttctgtgcgttcgcccatgcagtggatgataggtttgcagcgctg
ggagccatccgtgtgtcctccacaggagagggagatgagctgaacggacaggaggaagct
ttctcagcctgggcttgcactgcctttaaggatgcatgcaaggagtttaatattcaaggt
cagcttccagggaaagaaggtctggcagattcctgggatccacagaggcacagagttcag
aatgacagctgtacacttgaccgaatcacagctctgtcagctctccattctaaagcagtg
gttcccatgaaactaaagagaaggcagaatctacagaacccaaagtcaagtcgtgctaca
atattggtggagttagagatggatggaagcacagagaccttaaattttgtccctggagac
catgtagggattttcccagggaactcacctgaattagtagctggcatcctgaagcatctg
cccaatgcccctcctatcaatcagagcctacgcttggaattcctcagtgcctaccctgat
ggtgaaaggtggcagagagatgaacgcataccaccatgtcctcttgcccaagctctgacc
tattatctggatgtcaccaccccaccctcacaaagcctcctccgcaaactctcaaagata
gcaaagcaggaagatcacagacagcgtcacagacagcgcctgcttgcattagcatcagtt
tatgtccaagacatcttgcgagaacaactgaatgacaaggtctttgaggttctgcaccat
aatccagggcatctgtatatctgcggaggtatgaacatggcccatgatgtggctgccact
atcaaggaaatcttagtcagccggctgggcatcactcttactcaggctgaggaatatctg
tcaaggctcaagaatgagaagcggtaccatgaagacatctttggatcctag

DBGET integrated database retrieval system