KEGG   Clostridium cellulosi: CCDG5_0620Help
Entry
CCDG5_0620        CDS       T03806                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ccel  Clostridium cellulosi
Pathway
ccel03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ccel00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CCDG5_0620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccel03400]
    CCDG5_0620
Enzymes [BR:ccel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CCDG5_0620
DNA repair and recombination proteins [BR:ccel03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CCDG5_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CDZ23751
UniProt: A0A078KJE6
LinkDB All DBs
Position
I:complement(665008..667488)
Genome map
AA seq 826 aa AA seqDB search
MTEKLKEYNSKRNFEKTGEPRGIDVGEALKDTPEEGLRFAVQHHAARKDHYDLRLEWNGV
LLSWAVPKGPSYNPKDKRLAVKVEDHPLDYRSFEGTIPKGEYGGGTVMLWDEGFWEPQND
VDEGLSAGSLKFVLKGRRLKGKWVLIRLKAKEGEKKDNWIFLKEKDEYAQDDEGISEFDT
SIKTGRTMEEIGRGGDEKFIKNPISHADVQLAKLVNTVPEGQDWLFEVKYDGYRILAYLE
RNSARLITRNGNDYTGKFQSIADSLIEWANGRPMILDGEMVVTDPQGRTDFQALQSYLKN
RGGKNLVYIVFDLLALDGVDLRGRPLIERKETLENLLKTSPDNIYFSKHVRGNGKESFKA
ACELNLEGIVGKKADSVYSGTRNGDWIKLKCDKRQEFVIGGYTLSDKKAGGVSSLLLGFY
QENELIYAGRAGTGFSMREMRELESKFETLIRETSPFKQVPAPKKNEKVFWLEPELVAEI
KFTEWTEDNLLRQASFKGLRTDKDPKDIKIESTGDEMQTGENTKAEQPSETLAKAPTKAT
GNSIIIEGVKISNPDKVIFEDPVIKKVEVVQYYAAVAERMMPYVGNRILSIVRCPKGISS
SCFFKKHPGPGGQGTVTLPIETGSGETEDYFYIENMTGLVYEAQMGTLEFHIWGSRADNL
EKPDMMVFDLDPDEGMELEQVRQGVRDLKSILDQLSLISYLKTSGGKGYHIVVPFSPSAD
WNSFHDFAKRIAEVMEQKWPDRYTSNIRKDKRKNKIFIDWIRNARGATSIAPYSIRAKKG
APVSMPISWDELDTVSPNGIGMKDALERIKGSDPWENFYKVDQRLK
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaacttaaggaatacaattcaaaaagaaactttgagaaaaccggggaaccc
agaggcattgacgtgggtgaggccctcaaagatacgccggaagaagggctgaggtttgcg
gttcaacaccatgctgcccgcaaagaccactatgacttgcgccttgagtggaatggggtt
ctattaagctgggcggtgcctaaagggccgtcgtataaccccaaagacaaaaggctcgct
gttaaggttgaagatcaccctttggattacaggagttttgaggggactataccaaagggc
gaatacggcggcggcaccgtaatgctctgggacgagggcttttgggaaccgcagaatgat
gtggatgaggggctgagcgcgggttccctcaaatttgttctcaaaggcaggcggctcaag
ggaaaatgggtcttgatccgtttgaaagcaaaagagggcgagaaaaaggacaactggatt
tttttaaaggaaaaggacgagtacgcacaggacgatgaaggcatatcagagtttgataca
agcatcaaaaccggccgcaccatggaggaaatcggcagaggaggagatgaaaagtttata
aaaaaccccataagccacgcagatgtgcagcttgcaaagcttgtaaacactgtccctgag
gggcaggattggctttttgaggttaaatacgatggctaccggattctggcttatttggag
cgaaacagtgcgcggctcataacaagaaacggcaacgactataccggcaagtttcagagt
atcgcggattcgctcatcgaatgggcaaacggaaggccgatgatactcgacggtgagatg
gtggtcaccgacccgcaaggaagaacggattttcaggccctgcaaagctatttaaaaaac
cggggcggcaagaaccttgtctatatcgtctttgaccttctggcgttggacggagtggac
ttgagaggacgccccctgattgagcgaaaagaaacccttgaaaaccttttgaaaacttca
ccagacaacatttatttcagcaagcatgtcaggggaaacggcaaagaaagcttcaaagcg
gcctgcgaactgaaccttgaggggatagtgggcaaaaaggcagattccgtttacagcggc
acaagaaacggagactggattaagctcaaatgcgacaaaaggcaggaattcgtgataggc
ggttatacgctttcagacaaaaaagcgggcggggtaagctcgctgctcttggggttttat
caagagaatgaattgatttacgccgggcgcgccggaacaggtttttctatgcgggagatg
cgggaacttgaaagtaagtttgagacattaataagggaaacgtctcctttcaagcaagta
cctgccccaaagaaaaatgaaaaagtattctggcttgagcctgaacttgtcgcggaaatc
aagtttactgagtggacagaagataatctcttgagacaggcaagtttcaagggcctgcgg
acagacaaagatccgaaagatataaaaatagaaagcacaggtgatgaaatgcagactggc
gagaatacaaaagcggaacaaccgtccgaaactttagcaaaggctccaacgaaagcaacc
ggaaacagcataatcatcgaaggggtcaagataagcaatccggacaaggtaatttttgag
gacccggtaatcaaaaaggttgaggtggttcagtattacgcagcggtcgctgaacgtatg
atgccgtatgtcggcaacaggattctcagcatcgtccgctgccccaaaggaatttcgtcc
tcctgtttctttaaaaagcaccccggtccaggcggtcaagggacagttacactgccgatc
gaaaccggcagcggggaaacagaagattatttttatatagaaaacatgaccggacttgtc
tacgaagcccagatgggcacgctggaatttcatatctggggcagccgcgcggacaatctg
gaaaaaccggatatgatggtgtttgacctcgaccccgacgaagggatggagctcgaacaa
gtacgtcagggcgtccgggatctaaaaagcattctcgaccaattgtcgctgatttcatat
ctcaagacaagcggcggcaaaggataccatattgtcgtacccttcagcccctcggcggac
tggaactcgttccacgattttgcaaagcggattgccgaggtcatggaacagaagtggccg
gaccgatacacaagcaatatcagaaaggataagcgcaaaaacaagattttcattgactgg
atacgaaacgcaagaggcgccacaagtatcgccccctattccataagggcgaaaaaaggc
gcgcctgtttcaatgcctatctcatgggatgagcttgatactgtgtcccccaacggcatt
ggcatgaaagatgctctggaaagaatcaaaggcagtgacccgtgggaaaatttctataaa
gtagatcagcggctaaaataa

DBGET integrated database retrieval system